KEGG   Homo sapiens (human): 441531Help
Entry
441531            CDS       T01001                                 

Gene name
PGAM4, PGAM-B, PGAM1, PGAM3, dJ1000K24.1
Definition
(RefSeq) phosphoglycerate mutase family member 4
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00260  Glycine, serine and threonine metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa04922  Glucagon signaling pathway
hsa05230  Central carbon metabolism in cancer
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00002  Glycolysis, core module involving three-carbon compounds
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    441531 (PGAM4)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    441531 (PGAM4)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    441531 (PGAM4)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    441531 (PGAM4)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     441531 (PGAM4)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    441531 (PGAM4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   441531 (PGAM4)
  Exosomal proteins of melanoma cells
   441531 (PGAM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1 LysM
Motif
Other DBs
NCBI-GeneID: 441531
NCBI-ProteinID: NP_001025062
OMIM: 300567
HGNC: 21731
Ensembl: ENSG00000226784
Vega: OTTHUMG00000057865
Pharos: Q8N0Y7(Tdark)
UniProt: Q8N0Y7
Position
Xq21.1
AA seq 254 aa AA seqDB search
MAAYKLVLIRHGESTWNLENRFSCWYDADLSPAGHEEAKRGGQALRDAGYEFDICLTSVQ
KRVIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
VPPPPMEPDHPFYSNISKDRRYADLTEDQLPSYESPKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLQGIAKHVEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVC
KAIEAVAAQGKAKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctacaaactggtgctgatccggcacggcgagagcacatggaacctggagaac
cgcttcagctgctggtacgacgccgatctgagcccggcgggccacgaggaggcgaagcgc
ggcgggcaggcgctacgagatgctggctatgagtttgacatctgcctcacctcagtgcag
aagagagtgatccggaccctctggacagtgctagatgccattgatcagatgtggctgcca
gtggtgaggacttggcgcctcaatgagcggcactatgggggtctaaccggtctcaataaa
gcagaaactgctgcaaagcatggtgaggcccaggtgaagatctggaggcgctcctatgat
gtcccaccacctccgatggagcccgaccatcctttctacagcaacatcagtaaggatcgc
aggtatgcagacctcacagaagatcagctaccctcctatgagagtccgaaggatactatt
gccagagctctgcccttctggaatgaagaaatagttccccagatcaaggaggggaaacgt
gtactgattgcagcccatggcaacagcctccagggcattgccaagcatgtggagggtctc
tctgaagaggctatcatggagctgaacctgccgactggtattcccatcgtctatgaattg
gacaagaacttgaagcctatcaagcccatgcagtttctgggggatgaagagacggtgtgc
aaagccatagaagctgtggctgcccagggcaaggccaagaagtga

DBGET integrated database retrieval system