KEGG   Homo sapiens (human): 441531Help
Entry
441531            CDS       T01001                                 

Gene name
PGAM4, PGAM-B, PGAM1, PGAM3, dJ1000K24.1
Definition
(RefSeq) phosphoglycerate mutase family member 4 (EC:3.1.3.13 5.4.2.4 5.4.2.11)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    441531 (PGAM4)
   01230 Biosynthesis of amino acids
    441531 (PGAM4)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    441531 (PGAM4)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    441531 (PGAM4)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    441531 (PGAM4)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    441531 (PGAM4)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     441531 (PGAM4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   441531 (PGAM4)
  Exosomal proteins of melanoma cells
   441531 (PGAM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
UniProt: 
Position
Xq13
AA seq 254 aa AA seqDB search
MAAYKLVLIRHGESTWNLENRFSCWYDADLSPAGHEEAKRGGQALRDAGYEFDICLTSVQ
KRVIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
VPPPPMEPDHPFYSNISKDRRYADLTEDQLPSYESPKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLQGIAKHVEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVC
KAIEAVAAQGKAKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctacaaactggtgctgatccggcacggcgagagcacatggaacctggagaac
cgcttcagctgctggtacgacgccgatctgagcccggcgggccacgaggaggcgaagcgc
ggcgggcaggcgctacgagatgctggctatgagtttgacatctgcctcacctcagtgcag
aagagagtgatccggaccctctggacagtgctagatgccattgatcagatgtggctgcca
gtggtgaggacttggcgcctcaatgagcggcactatgggggtctaaccggtctcaataaa
gcagaaactgctgcaaagcatggtgaggcccaggtgaagatctggaggcgctcctatgat
gtcccaccacctccgatggagcccgaccatcctttctacagcaacatcagtaaggatcgc
aggtatgcagacctcacagaagatcagctaccctcctatgagagtccgaaggatactatt
gccagagctctgcccttctggaatgaagaaatagttccccagatcaaggaggggaaacgt
gtactgattgcagcccatggcaacagcctccagggcattgccaagcatgtggagggtctc
tctgaagaggctatcatggagctgaacctgccgactggtattcccatcgtctatgaattg
gacaagaacttgaagcctatcaagcccatgcagtttctgggggatgaagagacggtgtgc
aaagccatagaagctgtggctgcccagggcaaggccaagaagtga

DBGET integrated database retrieval system