KEGG   Homo sapiens (human): 442184Help
Entry
442184            CDS       T01001                                 

Gene name
OR2B3, 6M1-1, OR2B3P, OR6-14, OR6-4
Definition
olfactory receptor, family 2, subfamily B, member 3
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    442184 (OR2B3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    442184 (OR2B3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p22.1
AA seq 313 aa AA seqDB search
MNWENESSPKEFILLGFSDRAWLQMPLFVVLLISYTITIFGNVSIMMVCILDPKLHTPMY
FFLTNLSILDLCYTTTTVPHMLVNIGCNKKTISYAGCVAHLIIFLALGATECLLLAVMSF
DRYVAVCRPLHYVVIMNYWFCLRMAAFSWLIGFGNSVLQSSLTLNMPRCGHQEVDHFFCE
VPALLKLSCADTKPIEAELFFFSVLILLIPVTLILISYGFIAQAVLKIRSAEGRQKAFGT
CGSHMIVVSLFYGTAIYMYLQPPSSTSKDWGKMVSLFYGIITSMLNSLIYSLRNKDMKEA
FKRLMPRIFFCKK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaattgggaaaatgagagctccccaaaagagtttatactacttggcttctcagatagg
gcttggctacaaatgcccctttttgtggtcctgttaatatcatacacaatcaccatattt
ggcaatgtgtccatcatgatggtgtgcattctggatcccaaacttcatactcccatgtat
ttctttctcactaatctctccatcttagatctctgctataccacaactacagtccctcat
atgttggtaaatattggttgcaacaaaaagaccatcagctatgctggctgtgtggcccac
ctcatcatcttcctggccctaggtgctacagagtgtctccttctggctgttatgtccttt
gacagatatgtggctgtttgcagacccctccactatgtagtcatcatgaattattggttc
tgcctaaggatggcagccttctcatggctcattggtttcggcaactcagtgctgcagtct
tccttgactcttaacatgccacgctgtggtcaccaggaagtggaccactttttctgtgag
gtgcctgcacttctcaagttgtcatgtgctgacacaaagcctattgaggctgagctcttc
ttctttagtgtactaattcttctaattccagtgacattgatcctcatctcctatggcttc
atagctcaagcagtattaaaaatcaggtcagcagaaggacggcaaaaagcatttgggaca
tgtgggtcccacatgattgtggtgtccctcttttatggaacagccatttatatgtatctt
caaccaccttcatccacctctaaggactggggaaagatggtttccctcttctatggaatc
atcacatccatgttgaactccctcatctacagccttagaaataaagatatgaaggaggcc
ttcaagaggctgatgccaagaatctttttctgtaagaaataa

DBGET integrated database retrieval system