KEGG   Homo sapiens (human): 442191Help
Entry
442191            CDS       T01001                                 

Gene name
OR14J1, OR5U1, OR6-25, bA150A6.4, hs6M1-28
Definition
(RefSeq) olfactory receptor family 14 subfamily J member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    442191 (OR14J1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    442191 (OR14J1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 442191
NCBI-ProteinID: NP_112208
HGNC: 13971
Ensembl: ENSG00000204695
Vega: OTTHUMG00000031184
Pharos: Q9UGF5(Tdark)
UniProt: Q9UGF5 A0A126GW10
Position
6p22.1
AA seq 321 aa AA seqDB search
MVNLTSMSGFLLMGFSDERKLQILHALVFLVTYLLALTGNLLIITIITVDRRLHSPMYYF
LKHLSLLDLCFISVTVPQSIANSLMGNGYISLVQCILQVFFFIALASSEVAILTVMSYDR
YAAICQPLHYETIMDPRACRHAVIAVWIAGGLSGLMHAAINFSIPLCGKRVIHQFFCDVP
QMLKLACSYEFINEIALAAFTTSAAFICLISIVLSYIRIFSTVLRIPSAEGRTKVFSTCL
PHLFVATFFLSAAGFEFLRLPSDSSSTVDLVFSVFYTVIPPTLNPVIYSLRNDSMKAALR
KMLSKEELPQRKMCLKAMFKL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggtcaatttgacttcaatgagtggattccttcttatggggttttctgatgagcgtaag
cttcagattttacatgcattggtatttctggtgacatacctgctggccttgacaggcaac
ctcctcattatcaccatcattaccgtggaccgtcgtctccattcccccatgtattacttt
ttaaagcacctctctcttctggacctctgcttcatctctgtcacagtcccccagtccatt
gcaaattcacttatgggcaacggttacatttctcttgttcagtgcattcttcaggttttc
ttcttcatagctctggcctcatcagaagtggccattctcacagtgatgtcttatgacagg
tacgcagcaatctgtcaaccacttcattatgagactattatggatccccgtgcctgtagg
catgcagtgatagctgtgtggattgctgggggcctctctgggctcatgcatgctgccatt
aacttctccatacctctctgtgggaagagagtcattcaccaattcttctgtgatgttcct
cagatgctgaaactagcctgttcttatgaattcattaatgagattgcactggctgcattc
acaacgtctgcagcatttatctgtttgatctccattgtgctctcctacattcgcatcttc
tctacagtgctgagaatcccatcagctgagggccggaccaaggtcttctccacctgccta
ccacacctatttgtagccaccttctttctttcagctgcaggctttgagtttctcagactg
ccttctgattcctcatcgactgtggaccttgtattctccgtattctatactgtgatacct
ccaacactcaatccagtcatttatagcttacggaatgattccatgaaggcagcactgagg
aagatgctgtcaaaggaagagcttcctcagagaaaaatgtgcttaaaagccatgtttaaa
ctctga

DBGET integrated database retrieval system