KEGG   Homo sapiens (human): 442194Help
Entry
442194            CDS       T01001                                 

Gene name
OR10C1, OR10C1P, OR10C2, OR6-31, hs6M1-17
Definition
olfactory receptor, family 10, subfamily C, member 1
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
UniProt: 
Position
6p22.1
AA seq 312 aa AA seqDB search
MSANTSMVTEFLLLGFSHLADLQGLLFSVFLTIYLLTVAGNFLIVVLVSTDAALQSPMYF
FLRTLSALEIGYTSVTVPLLLHHLLTGRRHISRSGCALQMFFFLFFGATECCLLAAMAYD
RYAAICEPLRYPLLLSHRVCLQLAGSAWACGVLVGLGHTPFIFSLPFCGPNTIPQFFCEI
QPVLQLVCGDTSLNELQIILATALLILCPFGLILGSYGRILVTIFRIPSVAGRRKAFSTC
SSHLIMVSLFYGTALFIYIRPKASYDPATDPLVSLFYAVVTPILNPIIYSLRNTEVKAAL
KRTIQKTVPMEI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaaacacctccatggtgactgagtttcttcttctcggcttctcccacctggcc
gacctccagggcttgctcttctctgtctttctcactatctacctgctgaccgtggcaggc
aatttcctcattgtggtgctggtctccactgatgctgccctccagtcccctatgtacttc
ttcctgcgcaccctctcggccttggagattggctatacgtctgtcacggtccccctgcta
cttcaccacctccttactggccggcgccacatctctcgctctggatgtgctctccagatg
ttcttcttcctcttctttggcgccacggagtgctgcctcctggcagccatggcctatgac
cgctatgcagccatctgtgaacccctccgctacccactgctgctgagccaccgggtgtgt
ctacagctagctgggtcggcgtgggcctgtggggtgctggtggggctgggccacacccct
ttcatcttctctttgcccttctgcggccccaataccatcccgcagttcttctgtgagatc
cagcctgtcctgcagctggtatgtggagacacctcgcttaatgaactgcagattatcctg
gcaacagccctcctcatcctctgcccctttggcctcatcctgggctcctacgggcgtatc
ctcgttaccatcttccggatcccatctgttgcgggccgccgcaaggccttctccacctgc
tcctcccacctgatcatggtctccctcttctatggcaccgcactctttatctatattcgc
cctaaggccagctacgatccggccactgaccctctggtgtccctcttctatgctgtggtc
acccccatcctcaaccccatcatctacagcctgcggaacacagaggtcaaagctgcccta
aagagaaccatccagaaaacggtgcctatggagatttga

DBGET integrated database retrieval system