KEGG   Homo sapiens (human): 4437Help
Entry
4437              CDS       T01001                                 

Gene name
MSH3, DUP, FAP4, MRP1
Definition
(RefSeq) mutS homolog 3
  KO
K08736  
DNA mismatch repair protein MSH3
Organism
hsa  Homo sapiens (human)
Pathway
Platinum drug resistance
Mismatch repair
Pathways in cancer
Colorectal cancer
Disease
H00020  
Colorectal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03430 Mismatch repair
    4437 (MSH3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4437 (MSH3)
   05210 Colorectal cancer
    4437 (MSH3)
  Drug resistance
   01524 Platinum drug resistance
    4437 (MSH3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Mismatch and loop recognition factors
     4437 (MSH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P20585(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
5q14.1
AA seq 1137 aa AA seqDB search
MSRRKPASGGLAASSSAPARQAVLSRFFQSTGSLKSTSSSTGAADQVDPGAAAAAAAAAA
AAPPAPPAPAFPPQLPPHIATEIDRRKKRPLENDGPVKKKVKKVQQKEGGSDLGMSGNSE
PKKCLRTRNVSKSLEKLKEFCCDSALPQSRVQTESLQERFAVLPKCTDFDDISLLHAKNA
VSSEDSKRQINQKDTTLFDLSQFGSSNTSHENLQKTASKSANKRSKSIYTPLELQYIEMK
QQHKDAVLCVECGYKYRFFGEDAEIAARELNIYCHLDHNFMTASIPTHRLFVHVRRLVAK
GYKVGVVKQTETAALKAIGDNRSSLFSRKLTALYTKSTLIGEDVNPLIKLDDAVNVDEIM
TDTSTSYLLCISENKENVRDKKKGNIFIGIVGVQPATGEVVFDSFQDSASRSELETRMSS
LQPVELLLPSALSEQTEALIHRATSVSVQDDRIRVERMDNIYFEYSHAFQAVTEFYAKDT
VDIKGSQIISGIVNLEKPVICSLAAIIKYLKEFNLEKMLSKPENFKQLSSKMEFMTINGT
TLRNLEILQNQTDMKTKGSLLWVLDHTKTSFGRRKLKKWVTQPLLKLREINARLDAVSEV
LHSESSVFGQIENHLRKLPDIERGLCSIYHKKCSTQEFFLIVKTLYHLKSEFQAIIPAVN
SHIQSDLLRTVILEIPELLSPVEHYLKILNEQAAKVGDKTELFKDLSDFPLIKKRKDEIQ
GVIDEIRMHLQEIRKILKNPSAQYVTVSGQEFMIEIKNSAVSCIPTDWVKVGSTKAVSRF
HSPFIVENYRHLNQLREQLVLDCSAEWLDFLEKFSEHYHSLCKAVHHLATVDCIFSLAKV
AKQGDYCRPTVQEERKIVIKNGRHPVIDVLLGEQDQYVPNNTDLSEDSERVMIITGPNMG
GKSSYIKQVALITIMAQIGSYVPAEEATIGIVDGIFTRMGAADNIYKGQSTFMEELTDTA
EIIRKATSQSLVILDELGRGTSTHDGIAIAYATLEYFIRDVKSLTLFVTHYPPVCELEKN
YSHQVGNYHMGFLVSEDESKLDPGAAEQVPDFVTFLYQITRGIAARSYGLNVAKLADVPG
EILKKAAHKSKELEGLINTKRKRLKYFAKLWTMHNAQDLQKWTEEFNMEETQTSLLH
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccggaagcctgcgtcgggcggcctcgctgcctccagctcagcccctgcgagg
caagcggttttgagccgattcttccagtctacgggaagcctgaaatccacctcctcctcc
acaggtgcagccgaccaggtggaccctggcgctgcagcggctgcagcggccgcagcggcc
gcagcgcccccagcgcccccagctcccgccttcccgccccagctgccgccgcacatagct
acagaaattgacagaagaaagaagagaccattggaaaatgatgggcctgttaaaaagaaa
gtaaagaaagtccaacaaaaggaaggaggaagtgatctgggaatgtctggcaactctgag
ccaaagaaatgtctgaggaccaggaatgtttcaaagtctctggaaaaattgaaagaattc
tgctgcgattctgcccttcctcaaagtagagtccagacagaatctctgcaggagagattt
gcagttctgccaaaatgtactgattttgatgatatcagtcttctacacgcaaagaatgca
gtttcttctgaagattcgaaacgtcaaattaatcaaaaggacacaacactttttgatctc
agtcagtttggatcatcaaatacaagtcatgaaaatttacagaaaactgcttccaaatca
gctaacaaacggtccaaaagcatctatacgccgctagaattacaatacatagaaatgaag
cagcagcacaaagatgcagttttgtgtgtggaatgtggatataagtatagattctttggg
gaagatgcagagattgcagcccgagagctcaatatttattgccatttagatcacaacttt
atgacagcaagtatacctactcacagactgtttgttcatgtacgccgcctggtggcaaaa
ggatataaggtgggagttgtgaagcaaactgaaactgcagcattaaaggccattggagac
aacagaagttcactcttttcccggaaattgactgccctttatacaaaatctacacttatt
ggagaagatgtgaatcccctaatcaagctggatgatgctgtaaatgttgatgagataatg
actgatacttctaccagctatcttctgtgcatctctgaaaataaggaaaatgttagggac
aaaaaaaagggcaacatttttattggcattgtgggagtgcagcctgccacaggcgaggtt
gtgtttgatagtttccaggactctgcttctcgttcagagctagaaacccggatgtcaagc
ctgcagccagtagagctgctgcttccttcggccttgtccgagcaaacagaggcgctcatc
cacagagccacatctgttagtgtgcaggatgacagaattcgagtcgaaaggatggataac
atttattttgaatacagccatgctttccaggcagttacagagttttatgcaaaagataca
gttgacatcaaaggttctcaaattatttctggcattgttaacttagagaagcctgtgatt
tgctctttggctgccatcataaaatacctcaaagaattcaacttggaaaagatgctctcc
aaacctgagaattttaaacagctatcaagtaaaatggaatttatgacaattaatggaaca
acattaaggaatctggaaatcctacagaatcagactgatatgaaaaccaaaggaagtttg
ctgtgggttttagaccacactaaaacttcatttgggagacggaagttaaagaagtgggtg
acccagccactccttaaattaagggaaataaatgcccggcttgatgctgtatcggaagtt
ctccattcagaatctagtgtgtttggtcagatagaaaatcatctacgtaaattgcccgac
atagagaggggactctgtagcatttatcacaaaaaatgttctacccaagagttcttcttg
attgtcaaaactttatatcacctaaagtcagaatttcaagcaataatacctgctgttaat
tcccacattcagtcagacttgctccggaccgttattttagaaattcctgaactcctcagt
ccagtggagcattacttaaagatactcaatgaacaagctgccaaagttggggataaaact
gaattatttaaagacctttctgacttccctttaataaaaaagaggaaggatgaaattcaa
ggtgttattgacgagatccgaatgcatttgcaagaaatacgaaaaatactaaaaaatcct
tctgcacaatatgtgacagtatcaggacaggagtttatgatagaaataaagaactctgct
gtatcttgtataccaactgattgggtaaaggttggaagcacaaaagctgtgagccgcttt
cactctccttttattgtagaaaattacagacatctgaatcagctccgggagcagctagtc
cttgactgcagtgctgaatggcttgattttctagagaaattcagtgaacattatcactcc
ttgtgtaaagcagtgcatcacctagcaactgttgactgcattttctccctggccaaggtc
gctaagcaaggagattactgcagaccaactgtacaagaagaaagaaaaattgtaataaaa
aatggaaggcaccctgtgattgatgtgttgctgggagaacaggatcaatatgtcccaaat
aatacagatttatcagaggactcagagagagtaatgataattaccggaccaaacatgggt
ggaaagagctcctacataaaacaagttgcattgattaccatcatggctcagattggctcc
tatgttcctgcagaagaagcgacaattgggattgtggatggcattttcacaaggatgggt
gctgcagacaatatatataaaggacagagtacatttatggaagaactgactgacacagca
gaaataatcagaaaagcaacatcacagtccttggttatcttggatgaactaggaagaggg
acgagcactcatgatggaattgccattgcctatgctacacttgagtatttcatcagagat
gtgaaatccttaaccctgtttgtcacccattatccgccagtttgtgaactagaaaaaaat
tactcacaccaggtggggaattaccacatgggattcttggtcagtgaggatgaaagcaaa
ctggatccaggcgcagcagaacaagtccctgattttgtcaccttcctttaccaaataact
agaggaattgcagcaaggagttatggattaaatgtggctaaactagcagatgttcctgga
gaaattttgaagaaagcagctcacaagtcaaaagagctggaaggattaataaatacgaaa
agaaagagactcaagtattttgcaaagttatggacgatgcataatgcacaagacctgcag
aagtggacagaggagttcaacatggaagaaacacagacttctcttcttcattaa

DBGET integrated database retrieval system