KEGG   Homo sapiens (human): 4440Help
Entry
4440              CDS       T01001                                 

Gene name
MSI1
Definition
musashi RNA-binding protein 1
Orthology
K14411  
RNA-binding protein Musashi
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    4440 (MSI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24
AA seq 362 aa AA seqDB search
METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRS
RGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNT
TVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVE
CKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYT
YQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGST
PSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNG
YH
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggagactgacgcgccccagcccggcctcgcctccccggactcgccgcacgacccctgc
aagatgttcatcgggggactcagttggcagactacgcaggaagggctgcgcgaatacttc
ggccagttcggggaggtgaaggagtgtctggtgatgcgggaccccctgaccaagagatcc
aggggtttcggcttcgtcactttcatggaccaggcgggggtggataaagtgctggcgcaa
tcgcggcacgagctcgactccaaaacaattgaccctaaggtggccttccctcggcgagca
cagcccaagatggtgactcgaacgaagaagatctttgtgggggggctgtcggtgaacacc
acggtggaggacgtgaagcaatattttgagcagtttgggaaggtggacgacgccatgctg
atgtttgacaaaaccaccaaccggcaccgagggttcgggtttgtcacgtttgagagtgag
gacatcgtggagaaagtgtgtgaaattcattttcatgaaatcaacaacaaaatggtggaa
tgtaagaaagctcagccaaaggaggtgatgtcgccaacgggctcagcccgggggaggtct
cgagtcatgccctacggaatggacgccttcatgctgggcatcggcatgctgggttaccca
ggtttccaagccacaacctacgccagccggagttatacaggcctcgcccctggctacacc
taccagttccccgaattccgtgtagagcggacccctctcccgagcgccccagtcctcccc
gagcttacagccattcctctcactgcctacggaccaatggcggcggcagcggcggcagcg
gctgtggttcgagggacaggctctcacccctggacgatggctccccctccaggttcgact
cccagccgcacagggggcttcctggggaccaccagccccggccccatggccgagctctac
ggggcggccaaccaggactcgggggtcagcagttacatcagcgccgccagccctgccccc
agcaccggcttcggccacagtcttgggggccctttgattgccacagccttcaccaatggg
taccactga

DBGET integrated database retrieval system