KEGG   Homo sapiens (human): 4486Help
Entry
4486              CDS       T01001                                 

Gene name
MST1R, CD136, CDw136, PTK8, RON
Definition
(RefSeq) macrophage stimulating 1 receptor (EC:2.7.10.1)
  KO
K05100  
macrophage-stimulating 1 receptor [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Drug target
Narnatumab: 
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     4486 (MST1R)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Met family
   4486 (MST1R)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class VI (HGF receptor family)
   4486 (MST1R)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class VI (HGF receptor family)
   4486 (MST1R)
Cellular antigens [BR:hsa04090]
 Proteins
  4486 (MST1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p21.3
AA seq 1400 aa AA seqDB search
MELLPPLPQSFLLLLLLPAKPAAGEDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVT
YEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDT
KVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVAS
PLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPK
HLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDC
RFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGV
GPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNT
SCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSL
NYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAW
HFMGCGWCGNMCGQQKECPGSWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSG
LVPEGTHQVTVGQSPCRPLPKDSSKLRPVPRKDFVEEFECELEPLGTQAVGPTNVSLTVT
NMPPGKHFRVDGTSVLRGFSFMEPVLIAVQPLFGPRAGGTCLTLEGQSLSVGTSRAVLVN
GTECLLARVSEGQLLCATPPGATVASVPLSLQVGGAQVPGSWTFQYREDPVVLSISPNCG
YINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAG
NLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKPEEHAIKFEYIGLGAVADCVGINVTV
GGESCQHEFRGDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGPDGVPQSTLLG
ILLPLLLLVAALATALVFSYWWRRKQLVLPPNLNDLASLDQTAGATPLPILYSGSDYRSG
LALPAIDGLDSTTCVHGASFSDSEDESCVPLLRKESIQLRDLDSALLAEVKDVLIPHERV
VTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSRITEMQQVEAFLREGLLMRGLNH
PNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFGLQVARGMEYLA
EQKFVHRDLAARNCMLDESFTVKVADFGLARDILDREYYSVQQHRHARLPVKWMALESLQ
TYRFTTKSDVWSFGVLLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQPEYCPDSLYQVM
QQCWEADPAVRPTFRVLVGEVEQIVSALLGDHYVQLPATYMNLGPSTSHEMNVRPEQPQF
SPMPGNVRRPRPLSEPPRPT
NT seq 4203 nt NT seq  +upstreamnt  +downstreamnt
atggagctcctcccgccgctgcctcagtccttcctgttgctgctgctgttgcctgccaag
cccgcggcgggcgaggactggcagtgcccgcgcaccccctacgcggcctctcgcgacttt
gacgtgaagtacgtggtgcccagcttctccgccggaggcctggtacaggccatggtgacc
tacgagggcgacagaaatgagagtgctgtgtttgtagccatacgcaatcgcctgcatgtg
cttgggcctgacctgaagtctgtccagagcctggccacgggccctgctggagaccctggc
tgccagacgtgtgcagcctgtggcccaggaccccacggccctcccggtgacacagacaca
aaggtgctggtgctggatcccgcgctgcctgcgctggtcagttgtggctccagcctgcag
ggccgctgcttcctgcatgacctagagccccaagggacagccgtgcatctggcagcgcca
gcctgcctcttctcagcccaccataaccggcccgatgactgccccgactgtgtggccagc
ccattgggcacccgtgtaactgtggttgagcaaggccaggcctcctatttctacgtggca
tcctcactggacgcagccgtggctgccagcttcagcccacgctcagtgtctatcaggcgt
ctcaaggctgacgcctcgggattcgcaccgggctttgtggcgttgtcagtgctgcccaag
catcttgtctcctacagtattgaatacgtgcacagcttccacacgggagccttcgtatac
ttcctgactgtacagccggccagcgtgacagatgatcctagtgccctgcacacacgcctg
gcacggcttagcgccactgagccagagttgggtgactatcgggagctggtcctcgactgc
agatttgctccaaaacgcaggcgccggggggccccagaaggcggacagccctaccctgtg
ctgcgggtggcccactccgctccagtgggtgcccaacttgccactgagctgagcatcgcc
gagggccaggaagtactatttggggtctttgtgactggcaaggatggtggtcctggcgtg
ggccccaactctgtcgtctgtgccttccccattgacctgctggacacactaattgatgag
ggtgtggagcgctgttgtgaatccccagtccatccaggcctccggcgaggcctcgacttc
ttccagtcgcccagtttttgccccaacccgcctggcctggaagccctcagccccaacacc
agctgccgccacttccctctgctggtcagtagcagcttctcacgtgtggacctattcaat
gggctgttgggaccagtacaggtcactgcattgtatgtgacacgccttgacaacgtcaca
gtggcacacatgggcacaatggatgggcgtatcctgcaggtggagctggtcaggtcacta
aactacttgctgtatgtgtccaacttctcactgggtgacagtgggcagcccgtgcagcgg
gatgtcagtcgtcttggggaccacctactctttgcctctggggaccaggttttccaggta
cctatccaaggccctggctgccgccacttcctgacctgtgggcgttgcctaagggcatgg
catttcatgggctgtggctggtgtgggaacatgtgcggccagcagaaggagtgtcctggc
tcctggcaacaggaccactgcccacctaagcttactgagttccacccccacagtggacct
ctaaggggcagtacaaggctgaccctgtgtggctccaacttctaccttcacccttctggt
ctggtgcctgagggaacccatcaggtcactgtgggccaaagtccctgccggccactgccc
aaggacagctcaaaactcagaccagtgccccggaaagactttgtagaggagtttgagtgt
gaactggagcccttgggcacccaggcagtggggcctaccaacgtcagcctcaccgtgact
aacatgccaccgggcaagcacttccgggtagacggcacctccgtgctgagaggcttctct
ttcatggagccagtgctgatagcagtgcaacccctctttggcccacgggcaggaggcacc
tgtctcactcttgaaggccagagtctgtctgtaggcaccagccgggctgtgctggtcaat
gggactgagtgtctgctagcacgggtcagtgaggggcagcttttatgtgccacaccccct
ggggccacggtggccagtgtcccccttagcctgcaggtggggggtgcccaggtacctggt
tcctggaccttccagtacagagaagaccctgtcgtgctaagcatcagccccaactgtggc
tacatcaactcccacatcaccatctgtggccagcatctaacttcagcatggcacttagtg
ctgtcattccatgacgggcttagggcagtggaaagcaggtgtgagaggcagcttccagag
cagcagctgtgccgccttcctgaatatgtggtccgagacccccagggatgggtggcaggg
aatctgagtgcccgaggggatggagctgctggctttacactgcctggctttcgcttccta
cccccaccccatccacccagtgccaacctagttccactgaagcctgaggagcatgccatt
aagtttgagtatattgggctgggcgctgtggctgactgtgtgggtatcaacgtgaccgtg
ggtggtgagagctgccagcacgagttccggggggacatggttgtctgccccctgccccca
tccctgcagcttggccaggatggtgccccattgcaggtctgcgtagatggtgaatgtcat
atcctgggtagagtggtgcggccagggccagatggggtcccacagagcacgctccttggt
atcctgctgcctttgctgctgcttgtggctgcactggcgactgcactggtcttcagctac
tggtggcggaggaagcagctagttcttcctcccaacctgaatgacctggcatccctggac
cagactgctggagccacacccctgcctattctgtactcgggctctgactacagaagtggc
cttgcactccctgccattgatggtctggattccaccacttgtgtccatggagcatccttc
tccgatagtgaagatgaatcctgtgtgccactgctgcggaaagagtccatccagctaagg
gacctggactctgcgctcttggctgaggtcaaggatgtgctgattccccatgagcgggtg
gtcacccacagtgaccgagtcattggcaaaggccactttggagttgtctaccacggagaa
tacatagaccaggcccagaatcgaatccaatgtgccatcaagtcactaagtcgcatcaca
gagatgcagcaggtggaggccttcctgcgagaggggctgctcatgcgtggcctgaaccac
ccgaatgtgctggctctcattggtatcatgttgccacctgagggcctgccccatgtgctg
ctgccctatatgtgccacggtgacctgctccagttcatccgctcacctcagcggaacccc
accgtgaaggacctcatcagctttggcctgcaggtagcccgcggcatggagtacctggca
gagcagaagtttgtgcacagggacctggctgcgcggaactgcatgctggacgagtcattc
acagtcaaggtggctgactttggtttggcccgcgacatcctggacagggagtactatagt
gttcaacagcatcgccacgctcgcctacctgtgaagtggatggcgctggagagcctgcag
acctatagatttaccaccaagtctgatgtgtggtcatttggtgtgctgctgtgggaactg
ctgacacggggtgccccaccataccgccacattgacccttttgaccttacccacttcctg
gcccagggtcggcgcctgccccagcctgagtattgccctgattctctgtaccaagtgatg
cagcaatgctgggaggcagacccagcagtgcgacccaccttcagagtactagtgggggag
gtggagcagatagtgtctgcactgcttggggaccattatgtgcagctgccagcaacctac
atgaacttgggccccagcacctcgcatgagatgaatgtgcgtccagaacagccgcagttc
tcacccatgccagggaatgtacgccggccccggccactctcagagcctcctcggcccact
tga

DBGET integrated database retrieval system