KEGG   Homo sapiens (human): 4487Help
Entry
4487              CDS       T01001                                 

Gene name
MSX1, ECTD3, HOX7, HYD1, STHAG1
Definition
(RefSeq) msh homeobox 1
  KO
K09341  
homeobox protein MSX
Organism
hsa  Homo sapiens (human)
Pathway
HTLV-I infection
Disease
H00516  
Isolated orofacial clefts
H00625  
Tooth agenesis
H00643  
Tooth and nail syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    4487 (MSX1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Msh
    4487 (MSX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p16.2
AA seq 303 aa AA seqDB search
MAPAADMTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLP
FSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSV
GGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFT
TAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKM
AAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMY
HLT
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggccccggctgctgacatgacttctttgccactcggtgtcaaagtggaggactccgcc
ttcggcaagccggcggggggaggcgcgggccaggcccccagcgccgccgcggccacggca
gccgccatgggcgcggacgaggagggggccaagcccaaagtgtccccttcgctcctgccc
ttcagcgtggaggcgctcatggccgaccacaggaagccgggggccaaggagagcgccctg
gcgccctccgagggcgtgcaggcggcgggtggctcggcgcagccactgggcgtcccgccg
gggtcgctgggagccccggacgcgccctcttcgccgcggccgctcggccatttctcggtg
gggggactcctcaagctgccagaagatgcgctcgtcaaagccgagagccccgagaagccc
gagaggaccccgtggatgcagagcccccgcttctccccgccgccggccaggcggctgagc
cccccagcctgcaccctccgcaaacacaagacgaaccgtaagccgcggacgcccttcacc
accgcgcagctgctggcgctggagcgcaagttccgccagaagcagtacctgtccatcgcc
gagcgcgcggagttctccagctcgctcagcctcactgagacgcaggtgaagatatggttc
cagaaccgccgcgccaaggcaaagagactacaagaggcagagctggagaagctgaagatg
gccgccaagcccatgctgccaccggctgccttcggcctctccttccctctcggcggcccc
gcagctgtagcggccgcggcgggtgcctcgctctacggtgcctctggccccttccagcgc
gccgcgctgcctgtggcgcccgtgggactctacacggcccatgtgggctacagcatgtac
cacctgacatag

DBGET integrated database retrieval system