KEGG   Homo sapiens (human): 4501Help
Entry
4501              CDS       T01001                                 

Gene name
MT1X, MT-1l, MT1
Definition
(RefSeq) metallothionein 1X
  KO
K14739  metallothionein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    4501 (MT1X)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     4501 (MT1X)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Nuclear respiratory factors
    4501 (MT1X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallothio
Motif
Other DBs
NCBI-GeneID: 4501
NCBI-ProteinID: NP_005943
OMIM: 156359
HGNC: 7405
Ensembl: ENSG00000187193
Vega: OTTHUMG00000133280
Pharos: P80297(Tbio)
UniProt: P80297 A0A140VJP8
Position
16q13
AA seq 61 aa AA seqDB search
MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCC
A
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atggaccccaactgctcctgctcgcctgttggctcctgtgcctgtgccggctcctgcaaa
tgcaaagagtgcaaatgcacctcctgcaagaagagctgctgctcctgctgccctgtgggc
tgtgccaagtgtgcccagggctgcatctgcaaagggacgtcagacaagtgcagctgctgt
gcctga

DBGET integrated database retrieval system