KEGG   Homo sapiens (human): 4502Help
Entry
4502              CDS       T01001                                 

Gene name
MT2A, MT2
Definition
metallothionein 2A
Orthology
K14739  
metallothionein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
Mineral absorption
Class
Organismal Systems; Digestive system; Mineral absorption [PATH:hsa04978]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q13
AA seq 61 aa AA seqDB search
MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC
A
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atggatcccaactgctcctgcgccgccggtgactcctgcacctgcgccggctcctgcaaa
tgcaaagagtgcaaatgcacctcctgcaagaaaagctgctgctcctgctgccctgtgggc
tgtgccaagtgtgcccagggctgcatctgcaaaggggcgtcggacaagtgcagctgctgc
gcctga

DBGET integrated database retrieval system