KEGG   Homo sapiens (human): 4508Help
Entry
4508              CDS       T01001                                 

Gene name
ATP6, ATPase6, MTATP6, MT-ATP6, RP
Definition
ATP synthase F0 subunit 6
Orthology
K02126  
F-type H+-transporting ATPase subunit a
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
F-type ATPase, eukaryotes
Disease
H00068  
Leber optic atrophy
H01177  
Infantile bilateral striatal necrosis (IBSN)
H01355  
Kearns-Sayre Syndrome
H01363  
NARP syndrome
H01369  
ATP synthase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4508 (ATP6)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4508 (ATP6)
   05012 Parkinson's disease
    4508 (ATP6)
   05016 Huntington's disease
    4508 (ATP6)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   F-type ATPase
    4508 (ATP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
UniProt: 
Position
MT
AA seq 226 aa AA seqDB search
MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTM
HNTKGRTWSLMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVIMGFRSK
IKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLA
MSTINLPSTLIIFTILILLTILEIAVALIQAYVFTLLVSLYLHDNT
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaatctgttcgcttcattcattgcccccacaatcctaggcctacccgccgca
gtactgatcattctatttccccctctattgatccccacctccaaatatctcatcaacaac
cgactaatcaccacccaacaatgactaatcaaactaacctcaaaacaaatgataaccata
cacaacactaaaggacgaacctgatctcttatactagtatccttaatcatttttattgcc
acaactaacctcctcggactcctgcctcactcatttacaccaaccacccaactatctata
aacctagccatggccatccccttatgagcgggcacagtgattataggctttcgctctaag
attaaaaatgccctagcccacttcttaccacaaggcacacctacaccccttatccccata
ctagttattatcgaaaccatcagcctactcattcaaccaatagccctggccgtacgccta
accgctaacattactgcaggccacctactcatgcacctaattggaagcgccaccctagca
atatcaaccattaaccttccctctacacttatcatcttcacaattctaattctactgact
atcctagaaatcgctgtcgccttaatccaagcctacgttttcacacttctagtaagcctc
tacctgcacgacaacacataa

DBGET integrated database retrieval system