KEGG   Homo sapiens (human): 4509Help
Entry
4509              CDS       T01001                                 

Gene name
ATP8, ATPase8, MTATP8, MT-ATP8
Definition
(RefSeq) ATP synthase F0 subunit 8
  KO
K02125  
F-type H+-transporting ATPase subunit 8
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Thermogenesis
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
F-type ATPase, eukaryotes
Disease
H01355  
Kearns-Sayre syndrome
H01369  
ATP synthase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4509 (ATP8)
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    4509 (ATP8)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4509 (ATP8)
   05012 Parkinson's disease
    4509 (ATP8)
   05016 Huntington's disease
    4509 (ATP8)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   F-type ATPase
    4509 (ATP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Pharos: 
P03928(Tbio)
UniProt: 
Position
MT
AA seq 68 aa AA seqDB search
MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICS
LHSLPPQS
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgccccaactaaatactaccgtatggcccaccataattacccccatactccttacacta
ttcctcatcacccaactaaaaatattaaacacaaactaccacctacctccctcaccaaag
cccataaaaataaaaaattataacaaaccctgagaaccaaaatgaacgaaaatctgttcg
cttcattcattgcccccacaatcctag

DBGET integrated database retrieval system