KEGG   Homo sapiens (human): 4514Help
Entry
4514              CDS       T01001                                 

Gene name
COX3, COIII, MTCO3, MT-CO3
Definition
cytochrome c oxidase III
Orthology
K02262  
cytochrome c oxidase subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome c oxidase
Disease
H00068  
Leber optic atrophy
H01355  
Kearns-Sayre Syndrome
H01368  
Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4514 (COX3)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    4514 (COX3)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4514 (COX3)
   05012 Parkinson's disease
    4514 (COX3)
   05016 Huntington's disease
    4514 (COX3)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4514 (COX3)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    4514 (COX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
UniProt: 
Position
MT
AA seq 261 aa AA seqDB search
MTHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSMTLLMLGLLTNTLTMYQWWRD
VTRESTYQGHHTPPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTG
ITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMIQALLITILLGLYFTLLQASE
YFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAAW
YWHFVDVVWLFLYVSIYWWGS
NT seq 784 nt NT seq  +upstreamnt  +downstreamnt
atgacccaccaatcacatgcctatcatatagtaaaacccagcccatgacccctaacaggg
gccctctcagccctcctaatgacctccggcctagccatgtgatttcacttccactccata
acgctcctcatactaggcctactaaccaacacactaaccatataccaatgatggcgcgat
gtaacacgagaaagcacataccaaggccaccacacaccacctgtccaaaaaggccttcga
tacgggataatcctatttattacctcagaagtttttttcttcgcaggatttttctgagcc
ttttaccactccagcctagcccctaccccccaattaggagggcactggcccccaacaggc
atcaccccgctaaatcccctagaagtcccactcctaaacacatccgtattactcgcatca
ggagtatcaatcacctgagctcaccatagtctaatagaaaacaaccgaaaccaaataatt
caagcactgcttattacaattttactgggtctctattttaccctcctacaagcctcagag
tacttcgagtctcccttcaccatttccgacggcatctacggctcaacattttttgtagcc
acaggcttccacggacttcacgtcattattggctcaactttcctcactatctgcttcatc
cgccaactaatatttcactttacatccaaacatcactttggcttcgaagccgccgcctga
tactggcattttgtagatgtggtttgactatttctgtatgtctccatctattgatgaggg
tctt

DBGET integrated database retrieval system