KEGG   Homo sapiens (human): 4539Help
Entry
4539              CDS       T01001                                 

Gene name
ND4L, MTND4L, MT-ND4L
Definition
(RefSeq) NADH dehydrogenase, subunit 4L (complex I)
  KO
K03882  
NADH-ubiquinone oxidoreductase chain 4L [EC:1.6.5.3]
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Parkinson's disease
Module
NADH:ubiquinone oxidoreductase, mitochondria
Disease
H00068  
Leber hereditary optic atrophy (LHON)
H00473  
Mitochondrial respiratory chain deficiencies (MRCD)
H01355  
Kearns-Sayre syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4539 (ND4L)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    4539 (ND4L)
  Environmental adaptation
   04714 Thermogenesis
    4539 (ND4L)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    4539 (ND4L)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4539 (ND4L)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    4539 (ND4L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Pharos: 
P03901(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
MT
AA seq 98 aa AA seqDB search
MPLIYMNIMLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMATLMTLNTHSLLANIVP
IAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcatttacataaatattatactagcatttaccatctcacttctaggaatacta
gtatatcgctcacacctcatatcctccctactatgcctagaaggaataatactatcgctg
ttcattatagctactctcataaccctcaacacccactccctcttagccaatattgtgcct
attgccatactagtctttgccgcctgcgaagcagcggtgggcctagccctactagtctca
atctccaacacatatggcctagactacgtacataacctaaacctactccaatgctaa

DBGET integrated database retrieval system