KEGG   Homo sapiens (human): 4539Help
Entry
4539              CDS       T01001                                 

Gene name
ND4L, MTND4L, MT-ND4L
Definition
(RefSeq) NADH dehydrogenase, subunit 4L (complex I)
  KO
K03882  NADH-ubiquinone oxidoreductase chain 4L [EC:1.6.5.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa05012  Parkinson's disease
Module
hsa_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Disease
H00068  Leber hereditary optic atrophy (LHON)
H00473  Mitochondrial complex I deficiency
H01355  Kearns-Sayre syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4539 (ND4L)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    4539 (ND4L)
  Environmental adaptation
   04714 Thermogenesis
    4539 (ND4L)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    4539 (ND4L)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4539 (ND4L)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    4539 (ND4L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Oxidored_q2
Motif
Other DBs
NCBI-GeneID: 4539
NCBI-ProteinID: YP_003024034
OMIM: 516004
HGNC: 7460
Pharos: P03901(Tclin)
UniProt: P03901 Q7GXZ4
Structure
PDB: 

Jmol
Position
MT
AA seq 98 aa AA seqDB search
MPLIYMNIMLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMATLMTLNTHSLLANIVP
IAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcatttacataaatattatactagcatttaccatctcacttctaggaatacta
gtatatcgctcacacctcatatcctccctactatgcctagaaggaataatactatcgctg
ttcattatagctactctcataaccctcaacacccactccctcttagccaatattgtgcct
attgccatactagtctttgccgcctgcgaagcagcggtgggcctagccctactagtctca
atctccaacacatatggcctagactacgtacataacctaaacctactccaatgctaa

DBGET integrated database retrieval system