KEGG   Homo sapiens (human): 4540Help
Entry
4540              CDS       T01001                                 

Gene name
ND5, MTND5, MT-ND5
Definition
(RefSeq) NADH dehydrogenase, subunit 5 (complex I)
  KO
K03883  
NADH-ubiquinone oxidoreductase chain 5 [EC:1.6.5.3]
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Retrograde endocannabinoid signaling
Parkinson's disease
Module
NADH:ubiquinone oxidoreductase, mitochondria
Disease
H00068  
Leber hereditary optic atrophy (LHON)
H00473  
Mitochondrial respiratory chain deficiencies (MRCD)
H01347  
MELAS Syndrome
H01355  
Kearns-Sayre Syndrome
H01356  
Myoclonic Epilepsy and Ragged-Red Fiber Disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4540 (ND5)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    4540 (ND5)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    4540 (ND5)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4540 (ND5)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    4540 (ND5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Pharos: 
P03915(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
MT
AA seq 603 aa AA seqDB search
MTMHTTMTTLTLTSLIPPILTTLVNPNKKNSYPHYVKSIVASTFIISLFPTTMFMCLDQE
VIISNWHWATTQTTQLSLSFKLDYFSMMFIPVALFVTWSIMEFSLWYMNSDPNINQFFKY
LLIFLITMLILVTANNLFQLFIGWEGVGIMSFLLISWWYARADANTAAIQAILYNRIGDI
GFILALAWFILHSNSWDPQQMALLNANPSLTPLLGLLLAAAGKSAQLGLHPWLPSAMEGP
TPVSALLHSSTMVVAGIFLLIRFHPLAENSPLIQTLTLCLGAITTLFAAVCALTQNDIKK
IVAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAMLFMCSGSIIHNLNNEQDIRKMG
GLLKTMPLTSTSLTIGSLALAGMPFLTGFYSKDHIIETANMSYTNAWALSITLIATSLTS
AYSTRMILLTLTGQPRFPTLTNINENNPTLLNPIKRLAAGSLFAGFLITNNISPASPFQT
TIPLYLKLTALAVTFLGLLTALDLNYLTNKLKMKSPLCTFYFSNMLGFYPSITHRTIPYL
GLLTSQNLPLLLLDLTWLEKLLPKTISQHQISTSIITSTQKGMIKLYFLSFFFPLILTLL
LIT
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
ataaccatgcacactactataaccaccctaaccctgacttccctaattccccccatcctt
accaccctcgttaaccctaacaaaaaaaactcatacccccattatgtaaaatccattgtc
gcatccacctttattatcagtctcttccccacaacaatattcatgtgcctagaccaagaa
gttattatctcgaactgacactgagccacaacccaaacaacccagctctccctaagcttc
aaactagactacttctccataatattcatccctgtagcattgttcgttacatggtccatc
atagaattctcactgtgatatataaactcagacccaaacattaatcagttcttcaaatat
ctactcatcttcctaattaccatactaatcttagttaccgctaacaacctattccaactg
ttcatcggctgagagggcgtaggaattatatccttcttgctcatcagttgatgatacgcc
cgagcagatgccaacacagcagccattcaagcaatcctatacaaccgtatcggcgatatc
ggtttcatcctcgccttagcatgatttatcctacactccaactcatgagacccacaacaa
atagcccttctaaacgctaatccaagcctcaccccactactaggcctcctcctagcagca
gcaggcaaatcagcccaattaggtctccacccctgactcccctcagccatagaaggcccc
accccagtctcagccctactccactcaagcactatagttgtagcaggaatcttcttactc
atccgcttccaccccctagcagaaaatagcccactaatccaaactctaacactatgctta
ggcgctatcaccactctgttcgcagcagtctgcgcccttacacaaaatgacatcaaaaaa
atcgtagccttctccacttcaagtcaactaggactcataatagttacaatcggcatcaac
caaccacacctagcattcctgcacatctgtacccacgccttcttcaaagccatactattt
atgtgctccgggtccatcatccacaaccttaacaatgaacaagatattcgaaaaatagga
ggactactcaaaaccatacctctcacttcaacctccctcaccattggcagcctagcatta
gcaggaatacctttcctcacaggtttctactccaaagaccacatcatcgaaaccgcaaac
atatcatacacaaacgcctgagccctatctattactctcatcgctacctccctgacaagc
gcctatagcactcgaataattcttctcaccctaacaggtcaacctcgcttccccaccctt
actaacattaacgaaaataaccccaccctactaaaccccattaaacgcctggcagccgga
agcctattcgcaggatttctcattactaacaacatttcccccgcatcccccttccaaaca
acaatccccctctacctaaaactcacagccctcgctgtcactttcctaggacttctaaca
gccctagacctcaactacctaaccaacaaacttaaaataaaatccccactatgcacattt
tatttctccaacatactcggattctaccctagcatcacacaccgcacaatcccctatcta
ggccttcttacgagccaaaacctgcccctactcctcctagacctaacctgactagaaaag
ctattacctaaaacaatttcacagcaccaaatctccacctccatcatcacctcaacccaa
aaaggcataattaaactttacttcctctctttcttcttcccactcatcctaaccctactc
ctaatcacataa

DBGET integrated database retrieval system