KEGG   Homo sapiens (human): 4541Help
Entry
4541              CDS       T01001                                 

Gene name
ND6, MTND6, MT-ND6
Definition
(RefSeq) NADH dehydrogenase, subunit 6 (complex I)
  KO
K03884  
NADH-ubiquinone oxidoreductase chain 6 [EC:1.6.5.3]
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Retrograde endocannabinoid signaling
Parkinson's disease
Module
NADH:ubiquinone oxidoreductase, mitochondria
Disease
H00068  
Leber hereditary optic atrophy (LHON)
H00473  
Mitochondrial respiratory chain deficiencies (MRCD)
H01347  
MELAS Syndrome
H01355  
Kearns-Sayre Syndrome
H01365  
Leber hereditary optic neuropathy and dystonia (LDYT)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4541 (ND6)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    4541 (ND6)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    4541 (ND6)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4541 (ND6)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    4541 (ND6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Pharos: 
P03923(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
MT
AA seq 174 aa AA seqDB search
MMYALFLLSVGLVMGFVGFSSKPSPIYGGLVLIVSGVVGCVIILNFGGGYMGLMVFLIYL
GGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGLAMEVGLVLWVKEYDGVVVVVNFNS
VGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWTLFVGVYIVIEIARGN
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgatgtatgctttgtttctgttgagtgtgggtttagtaatggggtttgtggggttttct
tctaagccttctcctatttatgggggtttagtattgattgttagcggtgtggtcgggtgt
gttattattctgaattttgggggaggttatatgggtttaatagtttttttaatttattta
gggggaatgatggttgtctttggatatactacagcgatggctattgaggagtatcctgag
gcatgggggtcaggggttgaggtcttggtgagtgttttagtggggttagcgatggaggta
ggattggtgctgtgggtgaaagagtatgatggggtggtggttgtggtaaactttaatagt
gtaggaagctgaataatttatgaaggagaggggtcagggttgattcgggaggatcctatt
ggtgcgggggctttgtatgattatgggcgttgattagtagtagttactggttgaacattg
tttgttggtgtatatattgtaattgagattgctcgggggaatagg

DBGET integrated database retrieval system