KEGG   Homo sapiens (human): 4541Help
Entry
4541              CDS       T01001                                 

Gene name
ND6, MTND6, MT-ND6
Definition
(RefSeq) NADH dehydrogenase, subunit 6 (complex I)
  KO
K03884  
NADH-ubiquinone oxidoreductase chain 6 [EC:1.6.5.3]
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Parkinson's disease
Module
NADH:ubiquinone oxidoreductase, mitochondria
Disease
H00068  
Leber hereditary optic atrophy (LHON)
H00473  
Mitochondrial respiratory chain deficiencies (MRCD)
H01347  
MELAS Syndrome
H01355  
Kearns-Sayre syndrome
H01365  
Leber hereditary optic neuropathy and dystonia (LDYT)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4541 (ND6)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    4541 (ND6)
  Environmental adaptation
   04714 Thermogenesis
    4541 (ND6)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    4541 (ND6)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4541 (ND6)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    4541 (ND6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Pharos: 
P03923(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
MT
AA seq 174 aa AA seqDB search
MMYALFLLSVGLVMGFVGFSSKPSPIYGGLVLIVSGVVGCVIILNFGGGYMGLMVFLIYL
GGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGLAMEVGLVLWVKEYDGVVVVVNFNS
VGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWTLFVGVYIVIEIARGN
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgatgtatgctttgtttctgttgagtgtgggtttagtaatggggtttgtggggttttct
tctaagccttctcctatttatgggggtttagtattgattgttagcggtgtggtcgggtgt
gttattattctgaattttgggggaggttatatgggtttaatagtttttttaatttattta
gggggaatgatggttgtctttggatatactacagcgatggctattgaggagtatcctgag
gcatgggggtcaggggttgaggtcttggtgagtgttttagtggggttagcgatggaggta
ggattggtgctgtgggtgaaagagtatgatggggtggtggttgtggtaaactttaatagt
gtaggaagctgaataatttatgaaggagaggggtcagggttgattcgggaggatcctatt
ggtgcgggggctttgtatgattatgggcgttgattagtagtagttactggttgaacattg
tttgttggtgtatatattgtaattgagattgctcgggggaatagg

DBGET integrated database retrieval system