KEGG   Homo sapiens (human): 4544Help
Entry
4544              CDS       T01001                                 

Gene name
MTNR1B, FGQTL2, MEL-1B-R, MT2
Definition
(RefSeq) melatonin receptor 1B
  KO
K04286  
melatonin receptor type 1B
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Disease
H00409  
Type II diabetes mellitus
Drug target
Melatonin: 
Perlapine: 
Ramelteon: 
Tasimelteon: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4544 (MTNR1B)
 Organismal Systems
  Environmental adaptation
   04713 Circadian entrainment
    4544 (MTNR1B)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   Melatonin
    4544 (MTNR1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P49286(Tclin)
UniProt: 
Position
11q14.3
AA seq 362 aa AA seqDB search
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL
VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM
GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS
LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL
CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN
SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD
AL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagaacggctccttcgccaactgctgcgaggcgggcgggtgggcagtgcgcccg
ggctggtcgggggctggcagcgcgcggccctccaggacccctcgacctccctgggtggct
ccagcgctgtccgcggtgctcatcgtcaccaccgccgtggacgtcgtgggcaacctcctg
gtgatcctctccgtgctcaggaaccgcaagctccggaacgcaggtaatttgttcttggtg
agtctggcattggctgacctggtggtggccttctacccctacccgctaatcctcgtggcc
atcttctatgacggctgggccctgggggaggagcactgcaaggccagcgcctttgtgatg
ggcctgagcgtcatcggctctgtcttcaatatcactgccatcgccattaaccgctactgc
tacatctgccacagcatggcctaccaccgaatctaccggcgctggcacacccctctgcac
atctgcctcatctggctcctcaccgtggtggccttgctgcccaacttctttgtggggtcc
ctggagtacgacccacgcatctattcctgcaccttcatccagaccgccagcacccagtac
acggcggcagtggtggtcatccacttcctcctccctatcgctgtcgtgtccttctgctac
ctgcgcatctgggtgctggtgcttcaggcccgcaggaaagccaagccagagagcaggctg
tgcctgaagcccagcgacttgcggagctttctaaccatgtttgtggtgtttgtgatcttt
gccatctgctgggctccacttaactgcatcggcctcgctgtggccatcaacccccaagaa
atggctccccagatccctgaggggctatttgtcactagctacttactggcttatttcaac
agctgcctgaatgccattgtctatgggctcttgaaccaaaacttccgcagggaatacaag
aggatcctcttggccctttggaacccacggcactgcattcaagatgcttccaagggcagc
cacgcggaggggctgcagagcccagctccacccatcattggtgtgcagcaccaggcagat
gctctctag

DBGET integrated database retrieval system