KEGG   Homo sapiens (human): 4547Help
Entry
4547              CDS       T01001                                 

Gene name
MTTP, ABL, MTP
Definition
microsomal triglyceride transfer protein
Orthology
K14463  
microsomal triglyceride transfer protein large subunit
Organism
hsa  Homo sapiens (human)
Pathway
Fat digestion and absorption
Disease
H00160  
Abetalipoproteinemia
Drug target
Lomitapide: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    4547 (MTTP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q24
AA seq 894 aa AA seqDB search
MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGKLQDSVGYRIS
SNVDVALLWRNPDGDDDQLIQITMKDVNVENVNQQRGEKSIFKGKSPSKIMGKENLEALQ
RPTLLHLIHGKVKEFYSYQNEAVAIENIKRGLASLFQTQLSSGTTNEVDISGNCKVTYQA
HQDKVIKIKALDSCKIARSGFTTPNQVLGVSSKATSVTTYKIEDSFVIAVLAEETHNFGL
NFLQTIKGKIVSKQKLELKTTEAGPRLMSGKQAAAIIKAVDSKYTAIPIVGQVFQSHCKG
CPSLSELWRSTRKYLQPDNLSKAEAVRNFLAFIQHLRTAKKEEILQILKMENKEVLPQLV
DAVTSAQTSDSLEAILDFLDFKSDSSIILQERFLYACGFASHPNEELLRALISKFKGSIG
SSDIRETVMIITGTLVRKLCQNEGCKLKAVVEAKKLILGGLEKAEKKEDTRMYLLALKNA
LLPEGIPSLLKYAEAGEGPISHLATTALQRYDLPFITDEVKKTLNRIYHQNRKVHEKTVR
TAAAAIILNNNPSYMDVKNILLSIGELPQEMNKYMLAIVQDILRFEMPASKIVRRVLKEM
VAHNYDRFSRSGSSSAYTGYIERSPRSASTYSLDILYSGSGILRRSNLNIFQYIGKAGLH
GSQVVIEAQGLEALIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSDLMSKMLSA
SGDPISVVKGLILLIDHSQELQLQSGLKANIEVQGGLAIDISGAMEFSLWYRESKTRVKN
RVTVVITTDITVDSSFVKAGLETSTETEAGLEFISTVQFSQYPFLVCMQMDKDEAPFRQF
EKKYERLSTGRGYVSQKRKESVLAGCEFPLHQENSEMCKVVFAPQPDSTSSGWF
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgattcttcttgctgtgctttttctctgcttcatttcctcatattcagcttctgttaaa
ggtcacacaactggtctctcattaaataatgaccggctgtacaagctcacgtactccact
gaagttcttcttgatcggggcaaaggaaaactgcaagacagcgtgggctaccgcatttcc
tccaacgtggatgtggccttactatggaggaatcctgatggtgatgatgaccagttgatc
caaataacgatgaaggatgtaaatgttgaaaatgtgaatcagcagagaggagagaagagc
atcttcaaaggaaaaagcccatctaaaataatgggaaaggaaaacttggaagctctgcaa
agacctacgctccttcatctaatccatggaaaggtcaaagagttctactcatatcaaaat
gaggcagtggccatagaaaatatcaagagaggtctggctagcctatttcagacacagtta
agctctggaaccaccaatgaggtagatatctctggaaattgtaaagtgacctaccaggct
catcaagacaaagtgatcaaaattaaggccttggattcatgcaaaatagcgaggtctgga
tttacgaccccaaatcaggtcttgggtgtcagttcaaaagctacatctgtcaccacctat
aagatagaagacagctttgttatagctgtgcttgctgaagaaacacacaattttggactg
aatttcctacaaaccattaaggggaaaatagtatcgaagcagaaattagagctgaagaca
accgaagcaggcccaagattgatgtctggaaagcaggctgcagccataatcaaagcagtt
gattcaaagtacacggccattcccattgtggggcaggtcttccagagccactgtaaagga
tgtccttctctctcggagctctggcggtccaccaggaaatacctgcagcctgacaacctt
tccaaggctgaggctgtcagaaacttcctggccttcattcagcacctcaggactgcgaag
aaagaagagatccttcaaatactaaagatggaaaataaggaagtattacctcagctggtg
gatgctgtcacctctgctcagacctcagactcattagaagccattttggactttttggat
ttcaaaagtgacagcagcattatcctccaggagaggtttctctatgcctgtggatttgct
tctcatcccaatgaagaactcctgagagccctcattagtaagttcaaaggttctattggt
agcagtgacatcagagaaactgttatgatcatcactgggacacttgtcagaaagttgtgt
cagaatgaaggctgcaaactcaaagcagtagtggaagctaagaagttaatcctgggagga
cttgaaaaagcagagaaaaaagaggacaccaggatgtatctgctggctttgaagaatgcc
ctgcttccagaaggcatcccaagtcttctgaagtatgcagaagcaggagaagggcccatc
agccacctggctaccactgctctccagagatatgatctccctttcataactgatgaggtg
aagaagaccttaaacagaatataccaccaaaaccgtaaagttcatgaaaagactgtgcgc
actgctgcagctgctatcattttaaataacaatccatcctacatggacgtcaagaacatc
ctgctgtctattggggagcttccccaagaaatgaataaatacatgctcgccattgttcaa
gacatcctacgttttgaaatgcctgcaagcaaaattgtccgtcgagttctgaaggaaatg
gtcgctcacaattatgaccgtttctccaggagtggatcttcttctgcctacactggctac
atagaacgtagtccccgttcggcatctacttacagcctagacattctctactcgggttct
ggcattctaaggagaagtaacctgaacatctttcagtacattgggaaggctggtcttcac
ggtagccaggtggttattgaagcccaaggactggaagccttaatcgcagccacccctgac
gagggggaggagaaccttgactcctatgctggtatgtcagccatcctctttgatgttcag
ctcagacctgtcacctttttcaacggatacagtgatttgatgtccaaaatgctgtcagca
tctggcgaccctatcagtgtggtgaaaggacttattctgctaatagatcattctcaggaa
cttcagttacaatctggactaaaagccaatatagaggtccagggtggtctagctattgat
atttcaggtgcaatggagtttagcttgtggtatcgtgagtctaaaacccgagtgaaaaat
agggtgactgtggtaataaccactgacatcacagtggactcctcttttgtgaaagctggc
ctggaaaccagtacagaaacagaagcaggcttggagtttatctccacagtgcagttttct
cagtacccattcttagtttgcatgcagatggacaaggatgaagctccattcaggcaattt
gagaaaaagtacgaaaggctgtccacaggcagaggttatgtctctcagaaaagaaaagaa
agcgtattagcaggatgtgaattcccgctccatcaagagaactcagagatgtgcaaagtg
gtgtttgcccctcagccggatagtacttccagcggatggttttga

DBGET integrated database retrieval system