KEGG   Homo sapiens (human): 4548Help
Entry
4548              CDS       T01001                                 

Gene name
MTR, HMAG, MS, cblG
Definition
5-methyltetrahydrofolate-homocysteine methyltransferase (EC:2.1.1.13)
Orthology
K00548  
5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
hsa  Homo sapiens (human)
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of amino acids
Disease
H00262  
Spina bifida
H01285  
Methylcobalamin deficiency type G (cblG)
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:hsa00270]
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:hsa00450]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:hsa00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q43
AA seq 1265 aa AA seqDB search
MSPALQDLSQPEGLKKTLRDEINAILQKRIMVLDGGMGTMIQREKLNEEHFRGQEFKDHA
RPLKGNNDILSITQPDVIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNMC
SAGVARKAAEEVTLQTGIKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYQEQA
KGLLDGGVDILLIETIFDTANAKAALFALQNLFEEKYAPRPIFISGTIVDKSGRTLSGQT
GEGFVISVSHGEPLCIGLNCALGAAEMRPFIEIIGKCTTAYVLCYPNAGLPNTFGDYDET
PSMMAKHLKDFAMDGLVNIVGGCCGSTPDHIREIAEAVKNCKPRVPPATAFEGHMLLSGL
EPFRIGPYTNFVNIGERCNVAGSRKFAKLIMAGNYEEALCVAKVQVEMGAQVLDVNMDDG
MLDGPSAMTRFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEDD
FLEKARKIKKYGAAMVVMAFDEEGQATETDTKIRVCTRAYHLLVKKLGFNPNDIIFDPNI
LTIGTGMEEHNLYAINFIHATKVIKETLPGARISGGLSNLSFSFRGMEAIREAMHGVFLY
HAIKSGMDMGIVNAGNLPVYDDIHKELLQLCEDLIWNKDPEATEKLLRYAQTQGTGGKKV
IQTDEWRNGPVEERLEYALVKGIEKHIIEDTEEARLNQKKYPRPLNIIEGPLMNGMKIVG
DLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREETRVLNGTVEEEDPYQGTIVLATV
KGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEM
IFVAKEMERLAIRIPLLIGGATTSKTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDEN
LKDEYFEEIMEEYEDIRQDHYESLKERRYLPLSQARKSGFQMDWLSEPHPVKPTFIGTQV
FEDYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGGEARKVYDDAHNMLNTL
ISQKKLRARGVVGFWPAQSIQDDIHLYAEAAVPQAAEPIATFYGLRQQAEKDSASTEPYY
CLSDFIAPLHSGIRDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEE
LHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTG
IRLTESLAMAPASAVSGLYFSNLKSKYFAVGKISKDQVEDYALRKNISVAEVEKWLGPIL
GYDTD
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccgcgctccaagacctgtcgcaacccgaaggtctgaagaaaaccctgcgggat
gagatcaatgccattctgcagaagaggattatggtgctggatggagggatggggaccatg
atccagcgggagaagctaaacgaagaacacttccgaggtcaggaatttaaagatcatgcc
aggccgctgaaaggcaacaatgacattttaagtataactcagcctgatgtcatttaccaa
atccataaggaatacttgctggctggggcagatatcattgaaacaaatacttttagcagc
actagtattgcccaagctgactatggccttgaacacttggcctaccggatgaacatgtgc
tctgcaggagtggccagaaaagctgccgaggaggtaactctccagacaggaattaagagg
tttgtggcaggggctctgggtccgactaataagacactctctgtgtccccatctgtggaa
aggccggattataggaacatcacatttgatgagcttgttgaagcataccaagagcaggcc
aaaggacttctggatggcggggttgatatcttactcattgaaactatttttgatactgcc
aatgccaaggcagccttgtttgcactccaaaatctttttgaggagaaatatgctccccgg
cctatctttatttcagggacgatcgttgataaaagtgggcggactctttccggacagaca
ggagagggatttgtcatcagcgtgtctcatggagaaccactctgcattggattaaattgt
gctttgggtgcagctgaaatgagaccttttattgaaataattggaaaatgtacaacagcc
tatgtcctctgttatcccaatgcaggtcttcccaacacctttggtgactatgatgaaacg
ccttctatgatggccaagcacctaaaggattttgctatggatggcttggtcaatatagtt
ggaggatgctgtgggtcaacaccagatcatatcagggaaattgctgaagctgtgaaaaat
tgtaagcctagagttccacctgccactgcttttgaaggacatatgttactgtctggtcta
gagcccttcaggattggaccgtacaccaactttgttaacattggagagcgctgtaatgtt
gcaggatcaaggaagtttgctaaactcatcatggcaggaaactatgaagaagccttgtgt
gttgccaaagtgcaggtggaaatgggagcccaggtgttggatgtcaacatggatgatggc
atgctagatggtccaagtgcaatgaccagattttgcaacttaattgcttccgagccagac
atcgcaaaggtacctttgtgcatcgactcctccaattttgctgtgattgaagctgggtta
aagtgctgccaagggaagtgcattgtcaatagcattagtctgaaggaaggagaggacgac
ttcttggagaaggccaggaagattaaaaagtatggagctgctatggtggtcatggctttt
gatgaagaaggacaggcaacagaaacagacacaaaaatcagagtgtgcacccgggcctac
catctgcttgtgaaaaaactgggctttaatccaaatgacattatttttgaccctaatatc
ctaaccattgggactggaatggaggaacacaacttgtatgccattaattttatccatgca
acaaaagtcattaaagaaacattacctggagccagaataagtggaggtctttccaacttg
tccttctccttccgaggaatggaagccattcgagaagcaatgcatggggttttcctttac
catgcaatcaagtctggcatggacatggggatagtgaatgctggaaacctccctgtgtat
gatgatatccataaggaacttctgcagctctgtgaagatctcatctggaataaagaccct
gaggccactgagaagctcttacgttatgcccagactcaaggcacaggagggaagaaagtc
attcagactgatgagtggagaaatggccctgtcgaagaacgccttgagtatgcccttgtg
aagggcattgaaaaacatattattgaggatactgaggaagccaggttaaaccaaaaaaaa
tatccccgacctctcaatataattgaaggacccctgatgaatggaatgaaaattgttggt
gatctttttggagctggaaaaatgtttctacctcaggttataaagtcagcccgggttatg
aagaaggctgttggccaccttatccctttcatggaaaaagaaagagaagaaaccagagtg
cttaacggcacagtagaagaagaggacccttaccagggcaccatcgtgctggccactgtt
aaaggcgacgtgcacgacataggcaagaacatagttggagtagtccttggctgcaataat
ttccgagttattgatttaggagtcatgactccatgtgataagatactgaaagctgctctt
gaccacaaagcagatataattggcctgtcaggactcatcactccttccctggatgaaatg
atttttgttgccaaggaaatggagagattagctataaggattccattgttgattggagga
gcaaccacttcaaaaacccacacagcagttaaaatagctccgagatacagtgcacctgta
atccatgtcctggacgcgtccaagagtgtggtggtgtgttcccagctgttagatgaaaat
ctaaaggatgaatactttgaggaaatcatggaagaatatgaagatattagacaggaccat
tatgagtctctcaaggagaggagatacttacccttaagtcaagccagaaaaagtggtttc
caaatggattggctgtctgaacctcacccagtgaagcccacgtttattgggacccaggtc
tttgaagactatgacctgcagaagctggtggactacattgactggaagcctttctttgat
gtctggcagctccggggcaagtacccgaatcgaggctttcccaagatatttaacgacaaa
acagtaggtggagaggccaggaaggtctacgatgatgcccacaatatgctgaacacactg
attagtcaaaagaaactccgggcccggggtgtggttgggttctggccagcacagagtatc
caagacgacattcacctgtacgcagaggctgctgtgccccaggctgcagagcccatagcc
accttctatgggttaaggcaacaggctgagaaggactctgccagcacggagccatactac
tgcctctcagacttcatcgctcccttgcattctggcatccgtgactacctgggcctgttt
gccgttgcctgctttggggtagaagagctgagcaaggcctatgaggatgatggtgacgac
tacagcagcatcatggtcaaggcgctgggggaccggctggcagaggcctttgcagaagag
ctccatgaaagagttcgccgagaactgtgggcctactgtggcagtgagcagctggacgtc
gcagacctgcgcaggctgcggtacaagggcatccgcccggctcctggctaccccagccag
cccgaccacaccgagaagctcaccatgtggagactcgcagacatcgagcagtctacaggc
attaggttaacagaatcattagcaatggcacctgcttcagcagtctcaggcctctacttc
tccaatttgaagtccaaatattttgctgtggggaagatttccaaggatcaggttgaggat
tatgcattgaggaagaacatatctgtggctgaggttgagaaatggcttggacccattttg
ggatatgatacagactaa

DBGET integrated database retrieval system