KEGG   Homo sapiens (human): 4583Help
Entry
4583              CDS       T01001                                 

Gene name
MUC2, MLP, MUC-2, SMUC
Definition
mucin 2, oligomeric mucus/gel-forming
Orthology
K10955  
intestinal mucin-2
Organism
hsa  Homo sapiens (human)
Pathway
Vibrio cholerae infection
Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05110 Vibrio cholerae infection
    4583 (MUC2)
   05146 Amoebiasis
    4583 (MUC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.5
AA seq 5179 aa AA seqDB search
MGLPLARLAAVCLALSLAGGSELQTEGRTRNHGHNVCSTWGNFHYKTFDGDVFRFPGPCD
YNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTP
HYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSE
FLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
VPLEPYLRACQQDRCRCPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLV
YLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLY
TPGQEITNDCEQCVCNAGRWVCKDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKG
DHNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKNVVVFKSDGSVLLNELQVNLPHVTA
SFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFK
TASGLVEATGAGFANTWKAQSTCHDKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGR
CHSAVDPAEYYKRCKYDTCNCQNNEDCLCAALSSYARACTAKGVMLWGWREHVCNKDVGS
CPNSQVFLYNLTTCQQTCRSLSEADSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSC
YHRGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPR
ALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCN
TCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSF
SIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVV
ESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNS
WKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSC
SCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNR
SFETCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGA
SVPTEETCKSCVCTNSSQVVCRPEEGKILNQTQDGAFCYWEICGPNGTVEKHFNICSITT
RPSTLTTFTTITLPTTPTTFTTTTTTTTPTSSTVLSTTPKLCCLWSDWINEDHPSSGSDD
GDRETFDGVCGAPEDIECRSVKDPHLSLEQLGQKVQCDVSVGFICKNEDQFGNGPFGLCY
DYKIRVNCCWPMDKCITTPSPPTTTPSPPPTSTTTLPPTTTPSPPTTTTTTPPPTTTPSP
PITTTTTPPPTTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTP
SPPTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTT
TPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSP
PTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTT
PSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPP
TTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFH
KPGGDTELIGDVCGPGWAANISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGV
IPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTPPTTTPITTTTTVTPTPTPTGTQTPT
TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP
TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT
TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT
QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV
TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT
PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT
TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ
TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT
PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT
PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP
TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT
TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT
PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP
TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP
ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT
GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT
TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT
PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI
TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG
TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT
VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT
TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP
TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT
TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT
QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV
TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT
PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT
TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ
TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT
PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT
PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP
TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT
TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT
PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP
TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTGPPTH
TSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPT
TTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTPLSTPSII
RTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTP
SPTPTPSKSTPTPSKPSSTPSKPTPGTKPPECPDFDPPRQENETWWLCDCFMATCKYNNT
VEIVKVECEPPPMPTCSNGLQPVRVEDPDGCCWHWECDCYCTGWGDPHYVTFDGLYYSYQ
GNCTYVLVEEISPSVDNFGVYIDNYHCDPNDKVSCPRTLIVRHETQEVLIKTVHMMPMQV
QVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLSFSVRLPYHRFGNNTKG
QCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGK
TTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMPGSSLECASLQAYAAL
CAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNTVLVEGCFCPEG
TMNYAPGFDVCVKTCGCVGPDNVPREFGEHFEFDCKNCVCLEGGSGIICQPKRCSQKPVT
HCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKMVPGRCCPFYWC
ESKGVCVHGNAEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPCNTSCSPGFELM
EAPGECCKKCEQTHCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNIT
CPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGCTKTVLMNHCSG
SCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCG
LPTGTSRRARRSPRHLGSG
NT seq 15540 nt NT seq  +upstreamnt  +downstreamnt
atggggctgccactagcccgcctggcggctgtgtgcctggccctgtctttggcagggggc
tcggagctccagacagagggcagaacccgaaaccacggccacaacgtctgcagcacctgg
ggcaacttccactacaagaccttcgacggggacgtcttccgcttccccggcccctgcgac
tacaacttcgcctccgactgccgaggctcctacaaggaatttgctgtgcacctgaagcgg
ggtccgggccaggctgaggcccccgccggggtggagtccatcctgctgaccatcaaggat
gacaccatctacctcacccgccacctggctgtgcttaacggggccgtggtcagcaccccg
cactacagccccgggctgctcattgagaagagcgatgcctacaccaaagtctactcccgc
gccggcctcaccctcatgtggaaccgggaggatgcactcatgctggagctggacactaag
ttccggaaccacacctgtggcctctgcggggactacaacggcctgcagagctattcagaa
ttcctctctgacggcgtgctcttcagtcccctggagtttgggaacatgcagaagatcaac
cagcccgatgtggtgtgtgaggatcccgaggaggaggtggcccccgcatcctgctccgag
caccgcgccgagtgtgagaggctgctgaccgccgaggccttcgcggactgtcaggacctg
gtgccgctggagccgtatctgcgcgcctgccagcaggaccgctgccggtgcccgggcggt
gacacctgcgtctgcagcaccgtggccgagttctcccgccagtgctcccacgccggcggc
cggcccgggaactggaggaccgccacgctctgccccaagacctgccccgggaacctggtg
tacctggagagcggctcgccctgcatggacacctgctcacacctggaggtgagcagcctg
tgcgaggagcaccgcatggacggctgtttctgcccagaaggcaccgtatatgacgacatc
ggggacagtggctgcgttcctgtgagccagtgccactgcaggctgcacggacacctgtac
acaccgggccaggagatcaccaatgactgcgagcagtgtgtctgtaacgctggccgctgg
gtgtgcaaagacctgccctgccccggcacctgtgccctggaaggcggctcccacatcacc
accttcgatgggaagacgtacaccttccacggggactgctactatgtcctggccaagggt
gaccacaacgattcctacgctctcctgggcgagctggccccctgtggctccacagacaag
cagacctgcctgaagacggtggtgctgctggctgacaagaagaagaatgtggtggtcttc
aagtccgatggcagtgtactgctcaacgagctgcaggtgaacctgccccacgtgaccgcg
agcttctctgtcttccgcccgtcttcctaccacatcatggtgagcatggccattggcgtc
cggctgcaggtgcagctggccccagtcatgcaactctttgtgacactggaccaggcctcc
caggggcaggtgcagggcctctgcgggaacttcaacggcctggaaggtgacgacttcaag
acggccagcgggctggtggaggccacgggggccggctttgccaacacctggaaggcacag
tcaacctgccatgacaagctggactggttggacgatccctgctccctgaacatcgagagc
gccaactacgccgagcactggtgctccctcctgaagaagacagagaccccctttggcagg
tgccactcggctgtggaccctgctgagtattacaagaggtgcaaatatgacacgtgtaac
tgtcagaacaatgaggactgcctgtgcgccgccctgtcctcctacgcgcgcgcctgcacc
gccaagggcgtcatgctgtggggctggcgggagcatgtctgcaacaaggatgtgggctcc
tgccccaactcgcaggtcttcctgtacaacctgaccacctgccagcagacctgccgctcc
ctctccgaggccgacagccactgtctcgagggctttgcgcctgtggacggctgcggctgc
cctgaccacaccttcctggacgagaagggccgctgcgtacccctggccaagtgctcctgt
taccaccgcggtctctacctggaggcgggggacgtggtcgtcaggcaggaagaacgatgt
gtgtgccgggatgggcggctgcactgtaggcagatccggctgatcggccagagctgcacg
gccccaaagatccacatggactgcagcaacctgactgcactggccacctcgaagccccga
gccctcagctgccagacgctggccgccggctattaccacacagagtgtgtcagtggctgt
gtgtgccccgacgggctgatggatgacggccggggtggctgcgtggtggagaaggaatgc
ccttgcgtccataacaacgacctgtattcttccggcgccaagatcaaggtggactgcaat
acctgcacctgcaagagaggacgctgggtgtgcacccaggctgtgtgccatggcacctgc
tccatttacgggagtggccactacatcacctttgacgggaagtactacgactttgacgga
cactgctcctacgtggctgttcaggactactgcggccagaactcctcactgggctcattc
agcatcatcaccgagaacgtcccctgtggcactacgggcgtcacctgctccaaggccatc
aagatcttcatggggaggacggagctgaagttggaagacaagcaccgtgtggtgatccag
cgtgatgagggtcaccacgtggcctacaccacgcgggaggtgggccagtacctggtggtg
gagtccagcacgggcatcatcgtcatctgggacaagaggaccaccgtgttcatcaagctg
gctccctcctacaagggcaccgtgtgtggcctgtgtgggaactttgaccaccgctccaac
aacgacttcaccacgcgggaccacatggtggtgagcagcgagctggacttcgggaacagc
tggaaggaggcccccacctgcccagatgtgagcaccaaccccgagccctgcagcctgaac
ccgcaccgccgctcctgggccgagaagcagtgcagcatcctcaaaagcagcgtgttcagc
atctgccacagcaaggtggaccccaagcccttctacgaggcctgtgtgcacgactcgtgc
tcctgtgacacgggtggggactgtgagtgcttctgctctgccgtggcctcctacgcccag
gagtgtaccaaagagggggcctgcgtgttctggaggacgccggacctgtgccccatattc
tgcgactactacaaccctccgcatgagtgtgagtggcactatgagccatgtgggaaccgg
agcttcgagacctgcaggaccatcaatggcatccactccaacatctccgtgtcctacctg
gagggctgctacccccggtgccccaaggacaggcccatctatgaggaggatctgaagaag
tgtgtcactgcagacaagtgtggctgctatgtcgaggacacccactacccacctggagca
tcggttcccaccgaggagacctgcaagtcctgcgtgtgtaccaactcctcccaagtcgtc
tgcaggccggaggaaggaaagattcttaaccagacccaggatggcgccttctgctactgg
gagatctgtggccccaacgggacggtggagaagcacttcaacatctgttccattacgaca
cgcccgtccaccctgaccaccttcaccaccatcaccctccccaccacccccaccaccttc
accactaccaccaccaccaccaccccgacctccagcacagttttatcaacaactccgaag
ctgtgctgcctctggtctgactggatcaatgaggaccaccccagcagtggcagcgacgac
ggtgaccgagaaacatttgatggggtctgcggggcccctgaggacatcgagtgcaggtcg
gtcaaggatccccacctcagcttggagcagctaggccagaaggtgcagtgtgatgtctct
gttgggttcatttgcaagaatgaagaccagtttggaaatggaccatttggactgtgttac
gactacaagatacgtgtcaattgttgctggcccatggataagtgtatcaccactcccagc
cctccaactaccactcccagccctccaccaaccagcacgaccacccttccaccaaccacc
acccccagccctccaaccaccaccacaaccacccctccaccaaccaccacccccagccct
ccaataaccaccacgaccacccctccaccaaccaccactcccagccctccaataagcacc
acaaccacccctccaccaaccaccactcccagccctccaaccaccactcccagccctcca
accaccactcccagccctccaacaaccaccacaaccacccctccaccaaccaccactccc
agccctccaacgactacgcccatcactccaccagccagcactaccacccttccaccaacc
accactcccagccctccaacaaccaccacaaccacccctccaccaaccaccactcccagt
cctccaacgactacgcccatcactccaccaaccagcactactacccttccaccaaccacc
actcccagccctccaccaaccaccacaaccacccctccaccaaccaccactcccagccct
ccaacaaccaccactcccagtcctccaacaatcaccacaaccacccctccaccaaccacc
actcccagccctccaacaacgaccacaaccacccctccaccaaccaccactcccagccct
ccaacgactacacccatcactccaccaaccagcactaccacccttccaccaaccaccact
cccagccctccaccaaccaccacaaccacccctccaccaaccaccactcccagccctcca
acaaccaccactcccagccctccaataaccaccacaaccacccctccaccaaccaccact
cccagctctccaataaccaccactcccagccctccaacaaccaccatgaccaccccttca
ccaaccaccacccccagctctccaataaccaccacaaccaccccttcctcaactaccact
cccagccctccaccaaccaccatgaccaccccttcaccaaccaccactcccagccctcca
acaaccaccatgaccacccttccaccaaccaccacttccagccctctaacaactactcct
ctacctccatcaataactcctcctacattttcaccattctcaacgacaacccctactacc
ccatgcgtgcctctctgcaattggactggctggctggattctggaaaacccaactttcac
aaaccaggtggagacacagaattgattggagacgtctgtggaccaggctgggcagctaac
atctcttgcagagccaccatgtatcctgatgttcccattggacagcttggacaaacagtg
gtgtgtgatgtctctgtggggctgatatgcaaaaatgaagaccaaaagccaggtggggtc
atccctatggccttctgcctcaactacgagatcaacgttcagtgctgtgagtgtgtcacc
caacccaccaccatgacaaccaccaccacagagaacccaactccgccaaccacgacaccc
atcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaacc
acgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacag
accccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccacc
ggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacccca
acacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacc
ccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccact
acggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcacc
accaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgaca
cccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacccca
accacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcaca
cagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacaccc
accggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacc
ccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtg
accccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccacc
actacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatc
accaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacg
acacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacc
ccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggc
acacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaaca
cccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacccca
accccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacg
gtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccacc
accactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacaccc
atcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaacc
acgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacag
accccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccacc
ggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacccca
acacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacc
ccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccact
acggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcacc
accaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgaca
cccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacccca
accacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcaca
cagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacaccc
accggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacc
ccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtg
accccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccacc
actacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatc
accaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacg
acacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacc
ccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggc
acacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaaca
cccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacccca
accccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacg
gtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccacc
accactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacaccc
atcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaacc
acgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacag
accccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccacc
ggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacccca
acacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacc
ccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccact
acggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcacc
accaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgaca
cccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacccca
accacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcaca
cagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacaccc
accggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacc
ccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtg
accccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccacc
actacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatc
accaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacg
acacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacc
ccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggc
acacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaaca
cccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacccca
accccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacg
gtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccacc
accactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacaccc
atcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaacc
acgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacag
accccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccacc
ggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacccca
acacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacc
ccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccact
acggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcacc
accaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgaca
cccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacccca
accacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcaca
cagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacaccc
accggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacc
ccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtg
accccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccacc
actacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatc
accaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacg
acacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacc
ccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggc
acacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaaca
cccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacccca
accccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacg
gtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccacc
accactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacaccc
atcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaacc
acgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacag
accccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccacc
ggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacccca
acacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacc
ccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccact
acggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcacc
accaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgaca
cccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacccca
accacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcaca
cagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacaccc
accggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacc
ccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtg
accccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccacc
actacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatc
accaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacg
acacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacc
ccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggc
acacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaaca
cccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacccca
accccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacg
gtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccacc
accactacggtgaccccaaccccaacacccaccggcacacagaccgggccccccacccac
acaagcacagcaccgattgctgagttgaccacatccaatcctccgcctgagtcctcaacc
cctcagacctctcggtccacctcttcccctctcacggagtcaaccacccttctgagtacc
ctaccacctgccattgagatgaccagcacggccccaccctccacacccacggcacccacg
accacgagcggaggccacacactgtctccaccgcccagcaccaccacgtcccctccaggc
acccccactcgcggtaccacgactgggtcatcttcagcccccacccccagcactgtgcag
acgaccaccaccagtgcctggacccccacgccgaccccactctccacacccagcatcatc
aggaccacaggcctgaggccctacccttcctctgtgcttatctgctgtgtcctgaacgac
acctactacgcaccaggtgaggaggtgtacaacggcacatacggagacacctgttatttc
gtcaactgctcactgagctgtacgttggagttctataactggtcctgcccatccacgccc
tccccaacacccacgccctccaagtcgacgcccacgccttccaagccatcgtccacgccc
tccaagccgacgcccggcaccaagccccccgagtgcccagactttgatcctcccagacag
gagaacgagacttggtggctgtgcgactgcttcatggccacgtgcaagtacaacaacacg
gtggagatcgtgaaggtggagtgtgagccgccgcccatgcccacctgctccaacggcctc
caacccgtgcgcgtcgaggaccccgacggctgctgctggcactgggagtgcgactgctac
tgcacgggctggggcgacccgcactatgtcaccttcgacggactctactacagctaccag
ggcaactgcacctacgtgctggtggaggagatcagcccctccgtggacaacttcggagtt
tacatcgacaactaccactgcgatcccaacgacaaggtgtcctgcccccgcaccctcatc
gtgcgccacgagacccaggaggtgctgatcaagaccgtgcatatgatgcccatgcaggtg
caggtgcaggtgaacaggcaggcggtggcactgccctacaagaagtacgggctggaggtg
taccagtctggcatcaactacgtggtggacatccccgagctgggtgtcctcgtctcctac
aatggcctgtccttctccgtcaggctgccctaccaccggtttggcaacaacaccaagggc
cagtgtggcacctgcaccaacaccacctccgacgactgcattctgcccagcggggagatc
gtctccaactgtgaggctgcggctgaccagtggctggtgaacgacccctccaagccacac
tgcccccacagcagctccacgaccaagcgcccggccgtcactgtgcccgggggcggtaaa
acgaccccacacaaggactgcaccccatctcccctctgccagctcatcaaggacagcctg
tttgcccagtgccacgcactggtgcccccgcagcactactacgatgcctgcgtgttcgac
agctgcttcatgccgggctcgagcctggagtgcgccagtctgcaggcctacgcagccctc
tgtgcccagcagaacatctgcctcgactggcggaaccacacgcatggggcctgcttggtg
gagtgcccatctcacagggagtaccaggcctgtggccctgcagaagagcccacgtgcaaa
tccagctcctcccagcagaacaacacagtcctggtggaaggctgcttctgtcctgagggc
accatgaactacgctcctggctttgatgtctgcgtgaagacctgcggctgtgtgggacct
gacaatgtgcccagagagtttggggagcacttcgagttcgactgcaagaactgtgtctgc
ctggagggtggaagtggcatcatctgccaacccaagaggtgcagccagaagcccgttacc
cactgcgtggaagacggcacctacctcgccacggaggtcaaccctgccgacacctgctgc
aacattaccgtctgcaagtgcaacaccagcctgtgcaaagagaagccctccgtgtgcccg
ctgggattcgaagtgaagagcaagatggtgcctggaaggtgctgtcctttctactggtgt
gagtccaagggggtgtgtgttcacgggaatgctgagtaccagcccggttctccagtttat
tcctccaagtgccaggactgcgtgtgcacggacaaggtggacaacaacaccctgctcaac
gtcatcgcctgcacccacgtgccctgcaacacctcctgcagccctggcttcgaactcatg
gaggcccccggggagtgctgtaagaagtgtgaacagacgcactgtatcatcaaacggccc
gacaaccagcacgtcatcctgaagcccggggacttcaagagcgacccgaagaacaactgc
acattcttcagctgcgtgaagatccacaaccagctcatctcgtccgtctccaacatcacc
tgccccaactttgatgccagcatttgcatcccgggctccatcacattcatgcccaatgga
tgctgcaagacctgcacccctcgcaatgagaccagggtgccctgctccaccgtccccgtc
accacggaggtttcgtacgccggctgcaccaagaccgtcctcatgaatcattgctccggg
tcctgcgggacatttgtcatgtactcggccaaggcccaggccctggaccacagctgctcc
tgctgcaaagaggagaaaaccagccagcgtgaggtggtcctgagctgccccaatggcggc
tcgctgacacacacctacacccacatcgagagctgccagtgccaggacaccgtctgcggg
ctccccaccggcacctcccgccgggcccggcgctcccctaggcatctggggagcgggtga

DBGET integrated database retrieval system