KEGG   Homo sapiens (human): 4594Help
Entry
4594              CDS       T01001                                 

Gene name
MUT, MCM
Definition
(RefSeq) methylmalonyl-CoA mutase
  KO
K01847  
methylmalonyl-CoA mutase [EC:5.4.99.2]
Organism
hsa  Homo sapiens (human)
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Disease
H00174  
Methylmalonic aciduria (MMA)
H01400  
Secondary hyperammonemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4594 (MUT)
   00640 Propanoate metabolism
    4594 (MUT)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4594 (MUT)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     4594 (MUT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P22033(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
6p12.3
AA seq 750 aa AA seqDB search
MLRAKNQLFLLSPHYLRQVKESSGSRLIQQRLLHQQQPLHPEWAALAKKQLKGKNPEDLI
WHTPEGISIKPLYSKRDTMDLPEELPGVKPFTRGPYPTMYTFRPWTIRQYAGFSTVEESN
KFYKDNIKAGQQGLSVAFDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILFDGIPLE
KMSVSMTMNGAVIPVLANFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYIFPPEPSMK
IIADIFEYTAKHMPKFNSISISGYHMQEAGADAILELAYTLADGLEYSRTGLQAGLTIDE
FAPRLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLLRAHCQTSGWSLTE
QDPYNNIVRTAIEAMAAVFGGTQSLHTNSFDEALGLPTVKSARIARNTQIIIQEESGIPK
VADPWGGSYMMECLTNDVYDAALKLINEIEEMGGMAKAVAEGIPKLRIEECAARRQARID
SGSEVIVGVNKYQLEKEDAVEVLAIDNTSVRNRQIEKLKKIKSSRDQALAERCLAALTEC
AASGDGNILALAVDASRARCTVGEITDALKKVFGEHKANDRMVSGAYRQEFGESKEITSA
IKRVHKFMEREGRRPRLLVAKMGQDGHDRGAKVIATGFADLGFDVDIGPLFQTPREVAQQ
AVDADVHAVGISTLAAGHKTLVPELIKELNSLGRPDILVMCGGVIPPQDYEFLFEVGVSN
VFGPGTRIPKAAVQVLDDIEKCLEKKQQSV
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgttaagagctaagaatcagctttttttactttcacctcattacctgaggcaggtaaaa
gaatcatcaggctccaggctcatacagcaacgacttctacaccagcaacagccccttcac
ccagaatgggctgccctggctaaaaagcagctgaaaggcaaaaacccagaagacctaata
tggcacaccccggaagggatctctataaaacccttgtattccaagagagatactatggac
ttacctgaagaacttccaggagtgaagccattcacacgtggaccatatcctaccatgtat
acctttaggccctggaccatccgccagtatgctggttttagtactgtggaagaaagcaat
aagttctataaggacaacattaaggctggtcagcagggattatcagttgcctttgatctg
gcgacacatcgtggctatgattcagacaaccctcgagttcgtggtgatgttggaatggct
ggagttgctattgacactgtggaagataccaaaattctttttgatggaattcctttagaa
aaaatgtcagtttccatgactatgaatggagcagttattccagttcttgcaaattttata
gtaactggagaagaacaaggtgtacctaaagagaagcttactggtaccatccaaaatgat
atactaaaggaatttatggttcgaaatacatacatttttcctccagaaccatccatgaaa
attattgctgacatatttgaatatacagcaaagcacatgccaaaatttaattcaatttca
attagtggataccatatgcaggaagcaggggctgatgccattctggagctggcctatact
ttagcagatggattggagtactctagaactggactccaggctggcctgacaattgatgaa
tttgcaccaaggttgtctttcttctggggaattggaatgaatttctatatggaaatagca
aagatgagagctggtagaagactctgggctcacttaatagagaaaatgtttcagcctaaa
aactcaaaatctcttcttctaagagcacactgtcagacatctggatggtcacttactgag
caggatccctacaataatattgtccgtactgcaatagaagcaatggcagcagtatttgga
gggactcagtctttgcacacaaattcttttgatgaagctttgggtttgccaactgtgaaa
agtgctcgaattgccaggaacacacaaatcatcattcaagaagaatctgggattcccaaa
gtggctgatccttggggaggttcttacatgatggaatgtctcacaaatgatgtttatgat
gctgctttaaagctcattaatgaaattgaagaaatgggtggaatggccaaagctgtagct
gagggaatacctaaacttcgaattgaagaatgtgctgcccgaagacaagctagaatagat
tctggttctgaagtaattgttggagtaaataagtaccagttggaaaaagaagacgctgta
gaagttctggcaattgataatacttcagtgcgaaacaggcagattgaaaaacttaagaag
atcaaatccagcagggatcaagctttggctgaacgttgtcttgctgcactaaccgaatgt
gctgctagcggagatggaaatatcctggctcttgcagtggatgcatctcgggcaagatgt
acagtgggagaaatcacagatgccctgaaaaaggtatttggtgaacataaagcgaatgat
cgaatggtgagtggagcatatcgccaggaatttggagaaagtaaagagataacatctgct
atcaagagggttcataaattcatggaacgtgaaggtcgcagacctcgtcttcttgtagca
aaaatgggacaagatggccatgacagaggagcaaaagttattgctacaggatttgctgat
cttggttttgatgtggacataggccctcttttccagactcctcgtgaagtggcccagcag
gctgtggatgcggatgtgcatgctgtgggcataagcaccctcgctgctggtcataaaacc
ctagttcctgaactcatcaaagaacttaactcccttggacggccagatattcttgtcatg
tgtggaggggtgataccacctcaggattatgaatttctgtttgaagttggtgtttccaat
gtatttggtcctgggactcgaattccaaaggctgccgttcaggtgcttgatgatattgag
aagtgtttggaaaagaagcagcaatctgtataa

DBGET integrated database retrieval system