KEGG   Homo sapiens (human): 4595Help
Entry
4595              CDS       T01001                                 

Gene name
MUTYH, CYP2C, MYH
Definition
mutY homolog (EC:3.2.2.-)
Orthology
K03575  
A/G-specific adenine glycosylase [EC:3.2.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
Base excision repair
Disease
H01025  
Familial adenomatous polyposis
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:hsa03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p34.1
AA seq 535 aa AA seqDB search
MTPLVSRLSRLWAIMRKPRAAVGSGHRKQAASQEGRQKHAKNNSQAKPSACDGLARQPEE
VVLQASVSSYHLFRDVAEVTAFRGSLLSWYDQEKRDLPWRRRAEDEMDLDRRAYAVWVSE
VMLQQTQVATVINYYTGWMQKWPTLQDLASASLEEVNQLWAGLGYYSRGRRLQEGARKVV
EELGGHMPRTAETLQQLLPGVGRYTAGAIASIAFGQATGVVDGNVARVLCRVRAIGADPS
STLVSQQLWGLAQQLVDPARPGDFNQAAMELGATVCTPQRPLCSQCPVESLCRARQRVEQ
EQLLASGSLSGSPDVEECAPNTGQCHLCLPPSEPWDQTLGVVNFPRKASRKPPREESSAT
CVLEQPGALGAQILLVQRPNSGLLAGLWEFPSVTWEPSEQLQRKALLQELQRWAGPLPAT
HLRHLGEVVHTFSHIKLTYQVYGLALEGQTPVTTVPPGARWLTQEEFHTAAVSTAMKKVF
RVYQGQQPGTCMGSKRSQVSSPCSRKKPRMGQQVLDNFFRSHISTDAHSLNSAAQ
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgctcgtctcccgcctgagtcgtctgtgggccatcatgaggaagccacgagca
gccgtgggaagtggtcacaggaagcaggcagccagccaggaagggaggcagaagcatgct
aagaacaacagtcaggccaagccttctgcctgtgatggcctggccaggcagccggaagag
gtggtattgcaggcctctgtctcctcataccatctattcagagacgtagctgaagtcaca
gccttccgagggagcctgctaagctggtacgaccaagagaaacgggacctaccatggaga
agacgggcagaagatgagatggacctggacaggcgggcatatgctgtgtgggtctcagag
gtcatgctgcagcagacccaggttgccactgtgatcaactactataccggatggatgcag
aagtggcctacactgcaggacctggccagtgcttccctggaggaggtgaatcaactctgg
gctggcctgggctactattctcgtggccggcggctgcaggagggagctcggaaggtggta
gaggagctagggggccacatgccacgtacagcagagaccctgcagcagctcctgcctggc
gtggggcgctacacagctggggccattgcctctatcgcctttggccaggcaaccggtgtg
gtggatggcaacgtagcacgggtgctgtgccgtgtccgagccattggtgctgatcccagc
agcacccttgtttcccagcagctctggggtctagcccagcagctggtggacccagcccgg
ccaggagatttcaaccaagcagccatggagctaggggccacagtgtgtaccccacagcgc
ccactgtgcagccagtgccctgtggagagcctgtgccgggcacgccagagagtggagcag
gaacagctcttagcctcagggagcctgtcgggcagtcctgacgtggaggagtgtgctccc
aacactggacagtgccacctgtgcctgcctccctcggagccctgggaccagaccctggga
gtggtcaacttccccagaaaggccagccgcaagccccccagggaggagagctctgccacc
tgtgttctggaacagcctggggcccttggggcccaaattctgctggtgcagaggcccaac
tcaggtctgctggcaggactgtgggagttcccgtccgtgacctgggagccctcagagcag
cttcagcgcaaggccctgctgcaggaactacagcgttgggctgggcccctcccagccacg
cacctccggcaccttggggaggttgtccacaccttctctcacatcaagctgacatatcaa
gtatatgggctggccttggaagggcagaccccagtgaccaccgtaccaccaggtgctcgc
tggctgacgcaggaggaatttcacaccgcagctgtttccaccgccatgaaaaaggttttc
cgtgtgtatcagggccaacagccagggacctgtatgggttccaaaaggtcccaggtgtcc
tctccgtgcagtcggaaaaagccccgcatgggccagcaagtcctggataatttctttcgg
tctcacatctccactgatgcacacagcctcaacagtgcagcccagtga

DBGET integrated database retrieval system