KEGG   Homo sapiens (human): 4595Help
Entry
4595              CDS       T01001                                 

Gene name
MUTYH, MYH
Definition
(RefSeq) mutY DNA glycosylase (EC:3.2.2.-)
  KO
K03575  
A/G-specific adenine glycosylase [EC:3.2.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
Base excision repair
Disease
H01025  
Familial adenomatous polyposis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    4595 (MUTYH)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     4595 (MUTYH)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4595 (MUTYH)
 Prokaryotic Type
     4595 (MUTYH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p34.1
AA seq 546 aa AA seqDB search
MTPLVSRLSRLWAIMRKPRAAVGSGHRKQAASQEGRQKHAKNNSQAKPSACDGMIAECPG
APAGLARQPEEVVLQASVSSYHLFRDVAEVTAFRGSLLSWYDQEKRDLPWRRRAEDEMDL
DRRAYAVWVSEVMLQQTQVATVINYYTGWMQKWPTLQDLASASLEEVNQLWAGLGYYSRG
RRLQEGARKVVEELGGHMPRTAETLQQLLPGVGRYTAGAIASIAFGQATGVVDGNVARVL
CRVRAIGADPSSTLVSQQLWGLAQQLVDPARPGDFNQAAMELGATVCTPQRPLCSQCPVE
SLCRARQRVEQEQLLASGSLSGSPDVEECAPNTGQCHLCLPPSEPWDQTLGVVNFPRKAS
RKPPREESSATCVLEQPGALGAQILLVQRPNSGLLAGLWEFPSVTWEPSEQLQRKALLQE
LQRWAGPLPATHLRHLGEVVHTFSHIKLTYQVYGLALEGQTPVTTVPPGARWLTQEEFHT
AAVSTAMKKVFRVYQGQQPGTCMGSKRSQVSSPCSRKKPRMGQQVLDNFFRSHISTDAHS
LNSAAQ
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgctcgtctcccgcctgagtcgtctgtgggccatcatgaggaagccacgagca
gccgtgggaagtggtcacaggaagcaggcagccagccaggaagggaggcagaagcatgct
aagaacaacagtcaggccaagccttctgcctgtgatgggatgattgctgagtgtcctggg
gccccagcaggcctggccaggcagccggaagaggtggtattgcaggcctctgtctcctca
taccatctattcagagacgtagctgaagtcacagccttccgagggagcctgctaagctgg
tacgaccaagagaaacgggacctaccatggagaagacgggcagaagatgagatggacctg
gacaggcgggcatatgctgtgtgggtctcagaggtcatgctgcagcagacccaggttgcc
actgtgatcaactactataccggatggatgcagaagtggcctacactgcaggacctggcc
agtgcttccctggaggaggtgaatcaactctgggctggcctgggctactattctcgtggc
cggcggctgcaggagggagctcggaaggtggtagaggagctagggggccacatgccacgt
acagcagagaccctgcagcagctcctgcctggcgtggggcgctacacagctggggccatt
gcctctatcgcctttggccaggcaaccggtgtggtggatggcaacgtagcacgggtgctg
tgccgtgtccgagccattggtgctgatcccagcagcacccttgtttcccagcagctctgg
ggtctagcccagcagctggtggacccagcccggccaggagatttcaaccaagcagccatg
gagctaggggccacagtgtgtaccccacagcgcccactgtgcagccagtgccctgtggag
agcctgtgccgggcacgccagagagtggagcaggaacagctcttagcctcagggagcctg
tcgggcagtcctgacgtggaggagtgtgctcccaacactggacagtgccacctgtgcctg
cctccctcggagccctgggaccagaccctgggagtggtcaacttccccagaaaggccagc
cgcaagccccccagggaggagagctctgccacctgtgttctggaacagcctggggccctt
ggggcccaaattctgctggtgcagaggcccaactcaggtctgctggcaggactgtgggag
ttcccgtccgtgacctgggagccctcagagcagcttcagcgcaaggccctgctgcaggaa
ctacagcgttgggctgggcccctcccagccacgcacctccggcaccttggggaggttgtc
cacaccttctctcacatcaagctgacatatcaagtatatgggctggccttggaagggcag
accccagtgaccaccgtaccaccaggtgctcgctggctgacgcaggaggaatttcacacc
gcagctgtttccaccgccatgaaaaaggttttccgtgtgtatcagggccaacagccaggg
acctgtatgggttccaaaaggtcccaggtgtcctctccgtgcagtcggaaaaagccccgc
atgggccagcaagtcctggataatttctttcggtctcacatctccactgatgcacacagc
ctcaacagtgcagcccagtga

DBGET integrated database retrieval system