KEGG   Homo sapiens (human): 4598Help
Entry
4598              CDS       T01001                                 

Gene name
MVK, LRBP, MK, MVLK, POROK3
Definition
mevalonate kinase (EC:2.7.1.36)
Orthology
K00869  
mevalonate kinase [EC:2.7.1.36]
Organism
hsa  Homo sapiens (human)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Peroxisome
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Disease
H00206  
Mevalonate kinase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4598 (MVK)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    4598 (MVK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.36  mevalonate kinase
     4598 (MVK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24
AA seq 396 aa AA seqDB search
MLSEVLLVSAPGKVILHGEHAVVHGKVALAVSLNLRTFLRLQPHSNGKVDLSLPNIGIKR
AWDVARLQSLDTSFLEQGDVTTPTSEQVEKLKEVAGLPDDCAVTERLAVLAFLYLYLSIC
RKQRALPSLDIVVWSELPPGAGLGSSAAYSVCLAAALLTVCEEIPNPLKDGDCVNRWTKE
DLELINKWAFQGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSPALQILLTNTKVP
RNTRALVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLGEMGEAPAPEQYLVLEELIDM
NQHHLNALGVGHASLDQLCQVTRARGLHSKLTGAGGGGCGITLLKPGLEQPEVEATKQAL
TSCGFDCLETSIGAPGVSIHSATSLDSRVQQALDGL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcagaagtcctactggtgtctgctccggggaaagtcatccttcatggagaacat
gccgtggtacatggcaaggtagcactggctgtatccttgaacttgagaacattcctccgg
cttcaaccccacagcaatgggaaagtggacctcagcttacccaacattggtatcaagcgg
gcctgggatgtggccaggcttcagtcactggacacaagctttctggagcaaggtgatgtc
acaacacccacctcagagcaagtggagaagctaaaggaggttgcaggcttgcctgacgac
tgtgctgtcaccgagcgcctggctgtgctggcctttctttacttatacctgtccatctgc
cggaagcagagggccctgccgagcctggatatcgtagtgtggtcggagctgccccccggg
gcgggcttgggctccagcgccgcctactcggtgtgtctggcagcagccctcctgactgtg
tgcgaggagatcccaaacccgctgaaggacggggattgcgtcaacaggtggaccaaggag
gatttggagctaattaacaagtgggccttccaaggggagagaatgattcacgggaacccc
tccggagtggacaatgctgtcagcacctggggaggagccctccgataccatcaagggaag
atttcatccttaaagaggtcgccagctctccagatcctgctgaccaacaccaaagtccct
cgcaataccagggcccttgtggctggcgtcagaaacaggctgctcaagttcccagagatc
gtggcccccctcctgacctcaatagatgccatctccctggagtgtgagcgcgtgctggga
gagatgggggaagccccagccccggagcagtacctcgtgctggaagagctcattgacatg
aaccagcaccatctgaatgccctcggcgtgggccacgcctctctggaccagctctgccag
gtgaccagggcccgcggacttcacagcaagctgactggcgcaggcggtggtggctgtggc
atcacactcctcaagccagggctggagcagccagaagtggaggccacgaagcaggccctg
accagctgtggctttgactgcttggaaaccagcatcggtgcccccggcgtctccatccac
tcagccacctccctggacagccgagtccagcaagccctggatggcctctga

DBGET integrated database retrieval system