KEGG   Homo sapiens (human): 4599Help
Entry
4599              CDS       T01001                                 

Gene name
MX1, IFI-78K, IFI78, MX, MxA
Definition
(RefSeq) MX dynamin like GTPase 1
  KO
K14754  
interferon-induced GTP-binding protein Mx1
Organism
hsa  Homo sapiens (human)
Pathway
Measles
Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05162 Measles
    4599 (MX1)
   05164 Influenza A
    4599 (MX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P20591(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
21q22.3
AA seq 662 aa AA seqDB search
MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLR
ALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKW
RGKVSYQDYEIEISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLP
GITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGD
RTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREK
IFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETHQRITEELQKY
GVDIPEDENEKMFFLIDKVNAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIEN
NFQEGHKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMV
RLAFTDVSIKNFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRG
ALQKVREKELEEEKKKKSWDFGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLII
QFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQF
PG
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggttgtttccgaagtggacatcgcaaaagctgatccagctgctgcatcccaccctcta
ttactgaatggagatgctactgtggcccagaaaaatccaggctcggtggctgagaacaac
ctgtgcagccagtatgaggagaaggtgcgcccctgcatcgacctcattgactccctgcgg
gctctaggtgtggagcaggacctggccctgccagccatcgccgtcatcggggaccagagc
tcgggcaagagctccgtgttggaggcactgtcaggagttgcccttcccagaggcagcggg
atcgtgaccagatgcccgctggtgctgaaactgaagaaacttgtgaacgaagataagtgg
agaggcaaggtcagttaccaggactacgagattgagatttcggatgcttcagaggtagaa
aaggaaattaataaagcccagaatgccatcgccggggaaggaatgggaatcagtcatgag
ctaatcaccctggagatcagctcccgagatgtcccggatctgactctaatagaccttcct
ggcataaccagagtggctgtgggcaatcagcctgctgacattgggtataagatcaagaca
ctcatcaagaagtacatccagaggcaggagacaatcagcctggtggtggtccccagtaat
gtggacatcgccaccacagaggctctcagcatggcccaggaggtggaccccgagggagac
aggaccatcggaatcttgacgaagcctgatctggtggacaaaggaactgaagacaaggtt
gtggacgtggtgcggaacctcgtgttccacctgaagaagggttacatgattgtcaagtgc
cggggccagcaggagatccaggaccagctgagcctgtccgaagccctgcagagagagaag
atcttctttgagaaccacccatatttcagggatctgctggaggaaggaaaggccacggtt
ccctgcctggcagaaaaacttaccagcgagctcatcacacatatctgtaaatctctgccc
ctgttagaaaatcaaatcaaggagactcaccagagaataacagaggagctacaaaagtat
ggtgtcgacataccggaagacgaaaatgaaaaaatgttcttcctgatagataaagttaat
gcctttaatcaggacatcactgctctcatgcaaggagaggaaactgtaggggaggaagac
attcggctgtttaccagactccgacacgagttccacaaatggagtacaataattgaaaac
aattttcaagaaggccataaaattttgagtagaaaaatccagaaatttgaaaatcagtat
cgtggtagagagctgccaggctttgtgaattacaggacatttgagacaatcgtgaaacag
caaatcaaggcactggaagagccggctgtggatatgctacacaccgtgacggatatggtc
cggcttgctttcacagatgtttcgataaaaaattttgaagagttttttaacctccacaga
accgccaagtccaaaattgaagacattagagcagaacaagagagagaaggtgagaagctg
atccgcctccacttccagatggaacagattgtctactgccaggaccaggtatacaggggt
gcattgcagaaggtcagagagaaggagctggaagaagaaaagaagaagaaatcctgggat
tttggggctttccagtccagctcggcaacagactcttccatggaggagatctttcagcac
ctgatggcctatcaccaggaggccagcaagcgcatctccagccacatccctttgatcatc
cagttcttcatgctccagacgtacggccagcagcttcagaaggccatgctgcagctcctg
caggacaaggacacctacagctggctcctgaaggagcggagcgacaccagcgacaagcgg
aagttcctgaaggagcggcttgcacggctgacgcaggctcggcgccggcttgcccagttc
cccggttaa

DBGET integrated database retrieval system