KEGG   Homo sapiens (human): 4602Help
Entry
4602              CDS       T01001                                 

Gene name
MYB, Cmyb, c-myb, c-myb_CDS, efg
Definition
(RefSeq) MYB proto-oncogene, transcription factor
  KO
K09420  transcriptional activator Myb
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa05166  HTLV-I infection
Disease
H01508  Salivary gland cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    4602 (MYB)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    4602 (MYB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    4602 (MYB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cmyb_C Myb_DNA-binding Myb_DNA-bind_6 LMSTEN Myb_DNA-bind_7 SLIDE SANT_DAMP1_like Spore_III_AB
Motif
Other DBs
NCBI-GeneID: 4602
NCBI-ProteinID: NP_005366
OMIM: 189990
HGNC: 7545
Ensembl: ENSG00000118513
Vega: OTTHUMG00000015629
Pharos: P10242(Tbio)
UniProt: P10242 Q708E9
Position
6q23.3
AA seq 640 aa AA seqDB search
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGT
DDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAK
HLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTV
NNDYSYYHISEAQNVSSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELEL
LLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLT
STPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIK
YGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGNF
FCSHHWEGDSLNTQLFTQTSPVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLASP
LQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggcccgaagaccccggcacagcatatatagcagtgacgaggatgatgaggactttgag
atgtgtgaccatgactatgatgggctgcttcccaagtctggaaagcgtcacttggggaaa
acaaggtggacccgggaagaggatgaaaaactgaagaagctggtggaacagaatggaaca
gatgactggaaagttattgccaattatctcccgaatcgaacagatgtgcagtgccagcac
cgatggcagaaagtactaaaccctgagctcatcaagggtccttggaccaaagaagaagat
cagagagtgatagagcttgtacagaaatacggtccgaaacgttggtctgttattgccaag
cacttaaaggggagaattggaaaacaatgtagggagaggtggcataaccacttgaatcca
gaagttaagaaaacctcctggacagaagaggaagacagaattatttaccaggcacacaag
agactggggaacagatgggcagaaatcgcaaagctactgcctggacgaactgataatgct
atcaagaaccactggaattctacaatgcgtcggaaggtcgaacaggaaggttatctgcag
gagtcttcaaaagccagccagccagcagtggccacaagcttccagaagaacagtcatttg
atgggttttgctcaggctccgcctacagctcaactccctgccactggccagcccactgtt
aacaacgactattcctattaccacatttctgaagcacaaaatgtctccagtcatgttcca
taccctgtagcgttacatgtaaatatagtcaatgtccctcagccagctgccgcagccatt
cagagacactataatgatgaagaccctgagaaggaaaagcgaataaaggaattagaattg
ctcctaatgtcaaccgagaatgagctaaaaggacagcaggtgctaccaacacagaaccac
acatgcagctaccccgggtggcacagcaccaccattgccgaccacaccagacctcatgga
gacagtgcacctgtttcctgtttgggagaacaccactccactccatctctgccagcggat
cctggctccctacctgaagaaagcgcctcgccagcaaggtgcatgatcgtccaccagggc
accattctggataatgttaagaacctcttagaatttgcagaaacactccaatttatagat
tctttcttaaacacttccagtaaccatgaaaactcagacttggaaatgccttctttaact
tccacccccctcattggtcacaaattgactgttacaacaccatttcatagagaccagact
gtgaaaactcaaaaggaaaatactgtttttagaaccccagctatcaaaaggtcaatctta
gaaagctctccaagaactcctacaccattcaaacatgcacttgcagctcaagaaattaaa
tacggtcccctgaagatgctacctcagacaccctctcatctagtagaagatctgcaggat
gtgatcaaacaggaatctgatgaatctggaattgttgctgagtttcaagaaaatggacca
cccttactgaagaaaatcaaacaagaggtggaatctccaactgataaatcaggaaacttc
ttctgctcacaccactgggaaggggacagtctgaatacccaactgttcacgcagacctcg
cctgtggcagatgcaccgaatattcttacaagctccgttttaatggcaccagcatcagaa
gatgaagacaatgttctcaaagcatttacagtacctaaaaacaggtccctggcgagcccc
ttgcagccttgtagcagtacctgggaacctgcatcctgtggaaagatggaggagcagatg
acatcttccagtcaagctcgtaaatacgtgaatgcattctcagcccggacgctggtcatg
tga

DBGET integrated database retrieval system