KEGG   Homo sapiens (human): 4615Help
Entry
4615              CDS       T01001                                 

Gene name
MYD88, MYD88D
Definition
myeloid differentiation primary response 88
Orthology
K04729  
myeloid differentiation primary response protein MyD88
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Apoptosis
Toll-like receptor signaling pathway
Salmonella infection
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Toxoplasmosis
Tuberculosis
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Disease
H00721  
Pyogenic bacterial infections, recurrent, due to MYD88 deficiency
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; Legionellosis [PATH:hsa05134]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Malaria [PATH:hsa05144]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
Human Diseases; Infectious diseases; African trypanosomiasis [PATH:hsa05143]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p22
AA seq 159 aa AA seqDB search
MRPDRAEAPGPPAMAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADW
TALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP
SIGAAGWWWLSLMITCRARNVTSRPNLHSASLQVPIRSD
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcgacccgaccgcgctgaggctccaggaccgcccgccatggctgcaggaggtcccggc
gcggggtctgcggccccggtctcctccacatcctcccttcccctggctgctctcaacatg
cgagtgcggcgccgcctgtctctgttcttgaacgtgcggacacaggtggcggccgactgg
accgcgctggcggaggagatggactttgagtacttggagatccggcaactggagacacaa
gcggaccccactggcaggctgctggacgcctggcagggacgccctggcgcctctgtaggc
cgactgctcgagctgcttaccaagctgggccgcgacgacgtgctgctggagctgggaccc
agcattggtgccgccggatggtggtggttgtctctgatgattacctgcagagcaaggaat
gtgacttccagaccaaatttgcactcagcctctctccaggtgcccatcagaagcgactga

DBGET integrated database retrieval system