KEGG   Homo sapiens (human): 4615Help
Entry
4615              CDS       T01001                                 

Gene name
MYD88, MYD88D
Definition
myeloid differentiation primary response 88
Orthology
K04729  
myeloid differentiation primary response protein MyD88
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Apoptosis
Toll-like receptor signaling pathway
Salmonella infection
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Toxoplasmosis
Tuberculosis
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Disease
H00721  
Pyogenic bacterial infections, recurrent, due to MYD88 deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    4615 (MYD88)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    4615 (MYD88)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    4615 (MYD88)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    4615 (MYD88)
   05133 Pertussis
    4615 (MYD88)
   05134 Legionellosis
    4615 (MYD88)
   05152 Tuberculosis
    4615 (MYD88)
   05162 Measles
    4615 (MYD88)
   05164 Influenza A
    4615 (MYD88)
   05161 Hepatitis B
    4615 (MYD88)
   05168 Herpes simplex infection
    4615 (MYD88)
   05144 Malaria
    4615 (MYD88)
   05145 Toxoplasmosis
    4615 (MYD88)
   05140 Leishmaniasis
    4615 (MYD88)
   05142 Chagas disease (American trypanosomiasis)
    4615 (MYD88)
   05143 African trypanosomiasis
    4615 (MYD88)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p22
AA seq 159 aa AA seqDB search
MRPDRAEAPGPPAMAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADW
TALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP
SIGAAGWWWLSLMITCRARNVTSRPNLHSASLQVPIRSD
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcgacccgaccgcgctgaggctccaggaccgcccgccatggctgcaggaggtcccggc
gcggggtctgcggccccggtctcctccacatcctcccttcccctggctgctctcaacatg
cgagtgcggcgccgcctgtctctgttcttgaacgtgcggacacaggtggcggccgactgg
accgcgctggcggaggagatggactttgagtacttggagatccggcaactggagacacaa
gcggaccccactggcaggctgctggacgcctggcagggacgccctggcgcctctgtaggc
cgactgctcgagctgcttaccaagctgggccgcgacgacgtgctgctggagctgggaccc
agcattggtgccgccggatggtggtggttgtctctgatgattacctgcagagcaaggaat
gtgacttccagaccaaatttgcactcagcctctctccaggtgcccatcagaagcgactga

DBGET integrated database retrieval system