KEGG   Homo sapiens (human): 4616Help
Entry
4616              CDS       T01001                                 

Gene name
GADD45B, GADD45BETA, MYD118
Definition
(RefSeq) growth arrest and DNA damage inducible beta
  KO
K04402  
growth arrest and DNA-damage-inducible protein
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
FoxO signaling pathway
Cell cycle
p53 signaling pathway
Apoptosis
Cellular senescence
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Endometrial cancer
Glioma
Thyroid cancer
Basal cell carcinoma
Melanoma
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    4616 (GADD45B)
   04064 NF-kappa B signaling pathway
    4616 (GADD45B)
   04068 FoxO signaling pathway
    4616 (GADD45B)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    4616 (GADD45B)
   04210 Apoptosis
    4616 (GADD45B)
   04115 p53 signaling pathway
    4616 (GADD45B)
   04218 Cellular senescence
    4616 (GADD45B)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    4616 (GADD45B)
   05210 Colorectal cancer
    4616 (GADD45B)
   05212 Pancreatic cancer
    4616 (GADD45B)
   05225 Hepatocellular carcinoma
    4616 (GADD45B)
   05214 Glioma
    4616 (GADD45B)
   05216 Thyroid cancer
    4616 (GADD45B)
   05220 Chronic myeloid leukemia
    4616 (GADD45B)
   05217 Basal cell carcinoma
    4616 (GADD45B)
   05218 Melanoma
    4616 (GADD45B)
   05213 Endometrial cancer
    4616 (GADD45B)
   05224 Breast cancer
    4616 (GADD45B)
   05222 Small cell lung cancer
    4616 (GADD45B)
   05223 Non-small cell lung cancer
    4616 (GADD45B)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     4616 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     4616 (GADD45B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O75293(Tbio)
UniProt: 
Position
19p13.3
AA seq 160 aa AA seqDB search
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagacggtgacc
gccgcggtggaggagcttttggtggccgctcagcgccaggatcgcctcacagtgggggtg
tacgagtcggccaagttgatgaatgtggacccagacagcgtggtcctctgcctcttggcc
attgacgaggaggaggaggatgacatcgccctgcaaatccacttcacgctcatccagtcc
ttctgctgtgacaacgacatcaacatcgtgcgggtgtcgggcatgcagcgcctggcgcag
ctcctgggagagccggccgagacccagggcaccaccgaggcccgagacctgcattgtctc
ctggtcacgaaccctcacacggacgcctggaagagccacggcttggtggaggtggccagc
tactgcgaagaaagccggggcaacaaccagtgggtcccctacatctctcttcaggaacgc
tga

DBGET integrated database retrieval system