KEGG   Homo sapiens (human): 4616Help
Entry
4616              CDS       T01001                                 

Gene name
GADD45B, GADD45BETA, MYD118
Definition
growth arrest and DNA-damage-inducible, beta
Orthology
K04402  
growth arrest and DNA-damage-inducible protein
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
FoxO signaling pathway
Cell cycle
p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    4616 (GADD45B)
   04064 NF-kappa B signaling pathway
    4616 (GADD45B)
   04068 FoxO signaling pathway
    4616 (GADD45B)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    4616 (GADD45B)
   04115 p53 signaling pathway
    4616 (GADD45B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 160 aa AA seqDB search
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagacggtgacc
gccgcggtggaggagcttttggtggccgctcagcgccaggatcgcctcacagtgggggtg
tacgagtcggccaagttgatgaatgtggacccagacagcgtggtcctctgcctcttggcc
attgacgaggaggaggaggatgacatcgccctgcaaatccacttcacgctcatccagtcc
ttctgctgtgacaacgacatcaacatcgtgcgggtgtcgggcatgcagcgcctggcgcag
ctcctgggagagccggccgagacccagggcaccaccgaggcccgagacctgcattgtctc
ctggtcacgaaccctcacacggacgcctggaagagccacggcttggtggaggtggccagc
tactgcgaagaaagccggggcaacaaccagtgggtcccctacatctctcttcaggaacgc
tga

DBGET integrated database retrieval system