KEGG   Homo sapiens (human): 4619Help
Entry
4619              CDS       T01001                                 

Gene name
MYH1, HEL71, MYHSA1, MYHa, MyHC-2X/D, MyHC-2x
Definition
myosin, heavy chain 1, skeletal muscle, adult
Orthology
K10352  
myosin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    4619 (MYH1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   4619 (MYH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 1939 aa AA seqDB search
MSSDSEMAIFGEAAPFLRKSERERIEAQNKPFDAKTSVFVVDPKESFVKATVQSREGGKV
TAKTEAGATVTVKDDQVFPMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSG
LFCVTVNPYKWLPVYNAEVVTAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFATIAVTGEKKKEEVTSGKMQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQIMSNKKPDL
IEMLLITTNPYDYAFVSQGEITVPSIDDQEELMATDSAIEILGFTSDERVSIYKLTGAVM
HYGNMKFKQKQREEQAEPDGTEVADKAAYLQNLNSADLLKALCYPRVKVGNEYVTKGQTV
QQVYNAVGALAKAVYDKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLC
INFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEE
CMFPKATDTSFKNKLYEQHLGKSNNFQKPKPAKGKPEAHFSLIHYAGTVDYNIAGWLDKN
KDPLNETVVGLYQKSAMKTLALLFVGATGAEAEAGGGKKGGKKKGSSFQTVSALFRENLN
KLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYA
DFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIDIDHTQYKFGHTKVFFKAGLLGLLEEM
RDEKLAQLITRTQAMCRGFLARVEYQKMVERRESIFCIQYNVRAFMNVKHWPWMKLYFKI
KPLLKSAETEKEMANMKEEFEKTKEELAKTEAKRKELEEKMVTLMQEKNDLQLQVQAEAD
SLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDD
LELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKEKKALQEAHQQTLDDLQAEEDK
VNTLTKAKIKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLAQESTMDIENDKQQL
DEKLKKKEFEMSGLQSKIEDEQALGMQLQKKIKELQARIEELEEEIEAERASRAKAEKQR
SDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKH
ADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNMETVSKAKGNLEKMCRALEDQL
SEIKTKEEEQQRLINDLTAQRARLQTESGEYSRQLDEKDTLVSQLSRGKQAFTQQIEELK
RQLEEEIKAKSALAHALQSSRHDCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTKYE
TDAIQRTEELEEAKKKLAQRLQDAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERTN
AACAALDKKQRNFDKILAEWKQKCEETHAELEASQKESRSLSTELFKIKNAYEESLDQLE
TLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKSELQAALEEAEASLEHEEG
KILRIQLELNQVKSEVDRKIAEKDEEIDQMKRNHIRIVESMQSTLDAEIRSRNDAIRLKK
KMEGDLNEMEIQLNHANRMAAEALRNYRNTQAILKDTQLHLDDALRSQEDLKEQLAMVER
RANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDISQ
IQGEMEDIIQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHR
LDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNVEAVKGLRKHERKVKELTYQTEE
DRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQSNVNLSKFRRIQHELEEAEERADIAESQ
VNKLRVKSREVHTKIISEE
NT seq 5820 nt NT seq  +upstreamnt  +downstreamnt
atgagttccgactctgagatggccatttttggggaggctgctcctttcctccgaaagtct
gaaagggagcgaattgaagcccagaacaagccttttgatgccaagacatcagtctttgtg
gtggaccctaaggagtcctttgtgaaagcaacagtgcagagcagggaaggggggaaggtg
acagctaagaccgaagctggagctactgtaacagtgaaagatgaccaagtcttccccatg
aaccctcccaaatatgacaagatcgaggacatggccatgatgactcatctacacgagcct
gctgtgctgtacaacctcaaagagcgctacgcagcctggatgatctacacctactcaggc
ttgttctgtgtcactgtcaacccctacaagtggttgccagtgtataatgcagaggtggtg
acagcctaccgaggcaaaaagcgccaggaggccccaccccacatcttctccatctctgac
aatgcctatcagttcatgctgactgatcgggagaatcagtctatcttgatcaccggagaa
tctggcgcagggaagactgtgaacaccaagcgtgtcatccagtactttgcaacaattgca
gttactggggagaagaagaaggaagaagttacttctggcaaaatgcaggggactctggaa
gatcaaatcatcagtgccaaccccctactggaggcctttggcaacgccaagaccgtgagg
aatgacaactcctctcgctttggtaaattcatcaggatccacttcggtaccacagggaaa
ctggcttctgctgatattgaaacatatcttctggagaagtctagagttactttccagcta
aaggctgaaagaagctatcatattttttatcagatcatgtctaacaagaagccagatcta
attgaaatgctcctgatcaccaccaacccatacgattatgccttcgtcagtcaaggggag
atcacagtgcccagcattgatgaccaagaagagttgatggctacagatagtgccattgaa
attctgggctttacttcagatgaaagagtgtccatctataagctcacaggggctgtgatg
cattatgggaacatgaaattcaagcaaaagcagcgtgaggagcaagctgagccagatggc
actgaagttgctgacaaggcagcctatctccaaaatctgaactctgcagatctgctcaaa
gccctctgctaccctagggtcaaggtcggcaatgagtatgtcaccaaaggtcaaactgtg
cagcaggtgtacaatgcagtgggtgctctggccaaagctgtctacgataagatgttcttg
tggatggtcacccgcatcaaccagcagctggacaccaagcagcccaggcagtacttcatt
ggggtcttggacattgctggctttgagatctttgatttcaacagcctggagcagctgtgc
atcaacttcaccaatgagaaactgcaacagtttttcaaccaccacatgttcgtgctggag
caggaggagtacaagaaggaaggcattgagtggacgttcattgactttgggatggacctg
gctgcctgcatcgagctcatcgagaagcctatgggcatcttctccatcctggaagaggag
tgcatgttccccaaggcgacagacacctccttcaagaacaagctgtatgaacaacatctt
ggaaaatccaataacttccagaagcccaagcctgccaaaggcaagcctgaggcccacttc
tctttgattcactatgctggcaccgtggactacaacattgccggctggcttgacaagaac
aaggaccccctgaatgagactgtggtggggctgtaccagaagtctgcaatgaagactctg
gctctcctctttgttggggcaacgggagcggaagcagaggctggcggtggaaagaaaggt
ggtaagaagaagggttcttctttccagactgtgtctgctctcttcagggagaatttgaat
aagctgatgaccaacttgaggagcactcacccccactttgtgcggtgcatcatccccaat
gaaactaaaactcctggtgccatggagcatgagcttgtcctgcatcagctgaggtgtaac
ggtgtgctggaaggcatccgcatctgcaggaaaggcttcccaagcagaatcctttatgca
gacttcaaacagagatacaaggtgttaaatgcaagtgctatccctgaaggacaattcatc
gatagcaagaaggcttcagagaagctcctggggtccattgacattgaccacacccagtat
aaatttggtcacaccaaggtctttttcaaagctggtcttctggggctcctagaggagatg
cgagatgagaagctggcccagctgattacccgaacccaggccatgtgcagagggttcttg
gcaagagtggagtaccagaaaatggtggaaagaagagagtccatcttctgcatccagtac
aatgtccgtgccttcatgaatgtgaagcactggccctggatgaagctgtatttcaagatc
aaacccctcctcaaaagtgcagagacagagaaggagatggccaacatgaaggaagaattt
gagaaaaccaaagaagagctggctaagaccgaggcaaaaaggaaagagctggaagaaaaa
atggttactctgatgcaagaaaaaaatgacttgcaactccaggttcaagctgaagctgac
agcttggctgatgcagaggaaaggtgtgaccagctaatcaaaaccaaaatccagctagaa
gccaaaatcaaagaggtgactgagagagctgaggatgaggaagagatcaatgctgagctg
acagccaagaagaggaaactggaggatgaatgttcagaactcaagaaagacattgatgac
cttgagctgacactggccaaggttgagaaggagaaacatgccacagaaaacaaggtgaaa
aacctcacagaagagatggcgggtctggatgaaaccattgctaagctgaccaaggagaag
aaggctctccaggaggcccaccagcagaccctggatgacctgcaggcagaggaggacaaa
gtcaacaccctgaccaaagctaaaatcaaacttgaacaacaagtggatgatcttgaagga
tctttggaacaagaaaagaaaatccggatggatctagaaagagcaaagagaaaactagag
ggagacctaaaattggctcaagaatccacaatggatatagaaaatgacaaacaacaactt
gatgaaaagcttaaaaagaaagagtttgaaatgagcggtctgcaaagcaagattgaagat
gaacaagcccttggtatgcagctgcagaagaaaatcaaggagttacaagcccgcattgag
gagctggaggaggaaatcgaggcagagcgggcctcccgggccaaagcagagaagcagcgc
tctgatctctcccgggagctggaggagatcagcgagaggctggaagaagccggtggggcc
acctcagcccagattgagatgaacaagaagcgggaggctgagttccagaaaatgcgcagg
gacctggaggaggccaccctacagcatgaagccacggcggccaccctgaggaagaagcat
gcagatagtgtggccgagcttggggagcagattgacaacctgcagcgagtgaagcagaag
ctggagaaggagaagagtgagatgaagatggagatcgatgaccttgctagtaacatggag
actgtctccaaagccaagggaaaccttgaaaagatgtgccgcgctctagaagatcaactg
agtgaaattaagaccaaggaagaggagcagcagcggctgatcaatgacctcacagcacag
agagcgcgcctgcaaacagaatcaggtgaatattcacgccagctagatgaaaaggacaca
ctagtttcacagctctcgaggggcaaacaagcctttacacaacagattgaggaactgaaa
aggcaacttgaagaggagataaaggccaagagtgccctggcacatgccctgcagtcctcc
cgccatgactgtgacctgctgcgggaacagtatgaggaggagcaggaagccaaggccgag
ctacagagagcaatgtccaaggccaacagtgaggttgcccagtggaggaccaaatatgag
acagatgccatccagcgcacagaggagctggaggaggccaagaagaagctggctcagcgt
ctgcaggatgctgaggaacatgtagaagctgtgaatgccaaatgtgcttcccttgagaag
acgaagcagaggctccagaatgaagttgaggacctcatgattgatgttgagaggacaaat
gctgcctgtgccgccctggacaaaaagcaaaggaactttgataagatcctggcagaatgg
aaacagaagtgtgaagaaactcatgctgaacttgaagcttctcaaaaggaatcccgctca
ctcagcacagaactatttaagattaagaatgcttatgaggaatctttagaccaacttgaa
accttgaaacgggaaaataagaatttgcaacaggagatttctgatctcactgaacagatt
gcagaaggaggaaagcgcatccatgaactggaaaaaataaagaagcaagttgagcaagaa
aagtctgaacttcaggctgccttagaggaggcagaggcatctcttgaacatgaagaggga
aagatcctgcgcatccagcttgagttgaaccaagtcaagtctgaggttgataggaaaatt
gctgaaaaagatgaggaaattgaccagatgaagagaaaccacattagaatcgtggagtcc
atgcagagcacactggatgctgagatcaggagcaggaatgatgccattaggctcaagaag
aagatggagggagacctcaatgaaatggaaatccagctgaaccatgccaaccgcatggct
gctgaggccctgaggaactataggaacacccaagccatcctcaaggatacccagctccac
ctggatgatgctctccggagccaggaggacctgaaggaacagctggctatggtggagcgc
agagccaacctgctgcaggctgagatcgaggagctgcgggccactctggaacagacagag
aggagcaggaaaatcgcagaacaggagctcctggatgccagtgagcgtgttcagctcctg
cacacccagaacaccagcctgatcaacaccaagaagaagctggagacagacatttcccaa
atccagggagagatggaagacatcatccaggaagcccgcaatgcagaagagaaggccaag
aaggccatcactgatgctgccatgatggctgaggagctgaagaaggaacaggacaccagc
gcccatctggagcggatgaagaagaacctggaacagacggtgaaggacctgcagcatcgt
ctggatgaggctgagcagctggccctgaagggtgggaagaagcagatccagaaactggag
gccagggttcgtgaacttgaaggtgaagttgaaagtgaacagaagcgcaatgttgaagct
gtcaagggtctacgcaaacatgagagaaaagtgaaggaactcacttaccaaactgaggaa
gaccgcaagaatattctcaggctccaggacctggtggacaaactgcaagcaaaggtgaaa
tcctacaagagacaagctgaagaagcggaggaacaatccaacgtcaacctctccaaattc
cgcaggatccagcacgagctggaggaggccgaggaacgggctgacattgctgagtcccag
gtcaacaagctgagggtgaagagcagggaggttcacacaaaaatcataagtgaagagtaa

DBGET integrated database retrieval system