KEGG   Homo sapiens (human): 4620Help
Entry
4620              CDS       T01001                                 

Gene name
MYH2, IBM3, MYH2A, MYHSA2, MYHas8, MyHC-2A, MyHC-IIa
Definition
myosin, heavy chain 2, skeletal muscle, adult
Orthology
K10352  
myosin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Disease
H01229  
Inclusion body myopathy 3 (IBM3)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    4620 (MYH2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   4620 (MYH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 1941 aa AA seqDB search
MSSDSELAVFGEAAPFLRKSERERIEAQNRPFDAKTSVFVAEPKESFVKGTIQSREGGKV
TVKTEGGATLTVKDDQVFPMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSG
LFCVTVNPYKWLPVYKPEVVTAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFATIAVTGEKKKEEITSGKIQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVVFQLKAERSYHIFYQITSNKKPEL
IEMLLITTNPYDYPFVSQGEISVASIDDQEELMATDSAIDILGFTNEEKVSIYKLTGAVM
HYGNLKFKQKQREEQAEPDGTEVADKAAYLQSLNSADLLKALCYPRVKVGNEYVTKGQTV
EQVSNAVGALAKAVYEKMFLWMVARINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLC
INFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEE
CMFPKATDTSFKNKLYDQHLGKSANFQKPKVVKGKAEAHFALIHYAGVVDYNITGWLEKN
KDPLNETVVGLYQKSAMKTLAQLFSGAQTAEGEGAGGGAKKGGKKKGSSFQTVSALFREN
LNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRIL
YADFKQRYKVLNASAIPEGQFIDSKKASEKLLASIDIDHTQYKFGHTKVFFKAGLLGLLE
EMRDDKLAQLITRTQARCRGFLARVEYQRMVERREAIFCIQYNIRSFMNVKHWPWMKLFF
KIKPLLKSAETEKEMATMKEEFQKIKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQAE
AEGLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDI
DDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKEKKALQEAHQQTLDDLQAEE
DKVNTLTKAKIKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDIENEKQ
QLDEKLKKKEFEISNLQSKIEDEQALGIQLQKKIKELQARIEELEEEIEAERASRAKAEK
QRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRK
KHADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNVETVSKAKGNLEKMCRTLED
QLSELKSKEEEQQRLINDLTAQRGRLQTESGEFSRQLDEKEALVSQLSRGKQAFTQQIEE
LKRQLEEEIKAKNALAHALQSSRHDCDLLREQYEEEQESKAELQRALSKANTEVAQWRTK
YETDAIQRTEELEEAKKKLAQRLQAAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVER
TNAACAALDKKQRNFDKILAEWKQKCEETHAELEASQKEARSLGTELFKIKNAYEESLDQ
LETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKCELQAALEEAEASLEHE
EGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHIRIVESMQSTLDAEIRSRNDAIRL
KKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQIHLDDALRSQEDLKEQLAMV
ERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDI
SQMQGEMEDILQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQ
LRLDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNAEAVKGLRKHERRVKELTYQT
EEDRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQSNTNLAKFRKLQHELEEAEERADIAE
SQVNKLRVKSREVHTKVISEE
NT seq 5826 nt NT seq  +upstreamnt  +downstreamnt
atgagttcagactcagaattggctgtttttggggaggctgctcctttcctccgaaagtct
gaaagggagcgcattgaggcccagaataggccctttgatgccaaaacatctgtctttgtg
gcggagcccaaagaatcctttgtcaaagggaccatccagagcagagaaggaggaaaagtg
acggtgaagactgagggaggagcgactctgacagtgaaggatgatcaggtcttccccatg
aaccctcccaaatatgacaagatcgaggatatggccatgatgactcatctgcatgagcct
gctgtgctgtacaacctcaaagaacgttatgcagcctggatgatctacacctattcaggt
ctcttctgtgtcactgtcaacccctacaagtggctgcctgtgtataagcccgaggtggtg
acagcctaccgaggcaaaaagcgccaggaggccccgccccacatcttctccatctctgac
aacgcctatcagttcatgctgactgaccgagagaatcagtcaatcctgatcactggagaa
tctggtgcagggaagactgtgaacaccaagcgtgtcatccagtactttgcaacaattgca
gttactggtgagaagaagaaggaagaaattacttctggcaaaatacaggggactctggaa
gatcaaatcatcagtgccaaccccctactggaggcctttggcaacgccaagaccgtgagg
aatgacaactcctctcgctttggtaaattcatcagaatccactttggcactactggaaaa
ctggcatctgctgatattgaaacatatctgctagagaagtctagagttgttttccagctt
aaggctgagagaagttatcatattttttaccagattacatcgaataagaaaccagaactt
attgaaatgcttctgattaccacgaacccatatgattacccatttgtcagtcaaggggag
atcagtgtggccagcatcgatgatcaggaagaactgatggccacagatagtgctattgat
attttgggctttactaatgaagaaaaggtctccatttacaagctcacgggggctgtgatg
cattatgggaacctaaaatttaagcaaaagcagcgtgaggagcaagcagagccagatggc
acagaagttgctgacaaggcggcctacctccagagtctgaactctgcagatctgctcaaa
gctctctgctaccccagggtcaaggtcggcaatgagtatgtcaccaaaggccagactgta
gaacaggtgtccaacgcagtaggtgctctggccaaagccgtctacgagaagatgttcctg
tggatggttgcccgcatcaaccagcagctggacaccaagcagcccaggcagtacttcatc
ggggtcttggacattgctggttttgagatttttgatttcaacagcctggagcagctgtgc
atcaacttcaccaatgagaaactgcaacagtttttcaaccaccacatgttcgtgctggag
caggaggagtacaagaaggaaggcatcgagtggacgttcatcgacttcgggatggacctg
gctgcctgcatcgagctcatcgagaagcctatgggcatcttctccatcctggaagaggag
tgcatgttccctaaggcaacagacacctccttcaagaacaagctgtatgaccagcacctg
ggcaagtctgccaacttccagaagcccaaggtggtcaaaggcaaggccgaggcccacttc
gctctgattcactatgctggtgttgtggactacaacattactggctggctggagaagaac
aaggaccccctgaatgagaccgtggttggactgtaccagaagtctgcaatgaaaactcta
gctcagctcttctctggggctcaaactgctgaaggagagggagctggtggaggggccaag
aaaggtggtaagaagaagggctcttctttccagacagtgtctgcccttttcagagagaat
ttgaacaagctgatgaccaacctcaggagtacccatcctcactttgtgaggtgtatcatc
cccaatgagacaaaaactcctggtgccatggagcatgagcttgtcctccaccagctgagg
tgtaacggtgtgctggaaggcatccgcatctgtaggaaaggatttccaagcagaatcctt
tatgcagacttcaaacagagatacaaggtattaaatgcaagtgcaatccctgaagggcaa
ttcattgatagcaagaaggcctctgagaagctccttgcatccatcgacattgaccacacc
cagtataaatttgggcacaccaaggtctttttcaaagctggtcttctggggctcctagag
gagatgcgagatgacaagctggcccagctgattacccgaacccaggccaggtgcagaggg
ttcttggcaagagtggagtaccagaggatggtggagagaagggaggccatcttctgtatc
cagtacaatatcagatccttcatgaatgtcaagcactggccctggatgaaactcttcttc
aagatcaagcctctgttgaagagtgcagaaactgagaaggagatggccaccatgaaggaa
gaatttcagaaaattaaagacgaacttgccaagtcagaggcaaaaaggaaggaactggaa
gaaaagatggtgacgctgttgaaagaaaaaaatgacttgcagctccaagttcaggctgaa
gccgaaggcttggctgatgcagaggaaaggtgtgaccagctaatcaaaaccaaaatccag
ctagaagccaaaatcaaagaggtgactgagagagctgaggatgaggaagagatcaatgct
gagctgacagccaagaagaggaaactggaggatgaatgttcagaactcaagaaagacatt
gatgaccttgagctgacactggccaaggttgagaaggagaaacatgccacagaaaacaag
gtgaaaaacctcacagaagagatggcaggtctggatgaaaccattgctaagctgaccaag
gagaagaaggctctccaggaggcccaccagcagaccctggatgacctgcaggcagaggag
gacaaagtcaacaccctgaccaaagctaaaatcaaacttgaacaacaagtggatgatctt
gaagggtccttggagcaagaaaagaaacttcgcatggacctagaaagggctaagaggaaa
cttgagggtgacttgaagttggcccaagaatccataatggacattgaaaatgagaaacag
caacttgatgaaaagctcaaaaagaaagagtttgaaatcagcaatctgcaaagcaagatt
gaagatgaacaggcacttggcattcaattgcagaagaaaattaaagaattgcaagcccgc
attgaggagctggaggaggaaatcgaggcagagcgggcctcccgggccaaagcagagaag
cagcgctctgacctctcccgggagctggaggagatcagcgagaggctggaagaagccggt
ggggccacttcagcccagattgagatgaacaagaagcgggaggctgagttccagaaaatg
cgcagggacctggaggaggccaccctacagcatgaagccacagcggccaccctgaggaag
aagcatgcagatagtgtggccgagcttggggagcagattgacaacctgcagcgagtgaag
cagaagctggagaaggagaagagtgagatgaagatggagattgatgaccttgctagtaat
gtagaaacggtctccaaagccaagggaaacctagagaaaatgtgccggactctagaggac
caactgagtgaactgaaatcaaaggaagaggagcagcagcggctgatcaatgacctgact
gcgcagagggggcgcctgcagactgaatctggtgagttttcacgccagcttgatgaaaag
gaagctctggtgtctcagttatcaagaggcaaacaagcctttactcaacagattgaagaa
ttaaagaggcaacttgaagaggagataaaagccaagaacgccctggcgcatgccctgcag
tcttcccgccacgactgtgacctgctgcgggaacagtatgaggaggagcaggaatccaag
gccgagctgcagagagcactgtccaaggccaacaccgaggttgcccaatggaggaccaaa
tacgagacggacgccatccagcgcacagaggagctggaggaggccaagaagaagctggcc
cagcggctgcaggcagctgaggaacatgtagaagctgtgaacgccaaatgtgcttccctc
gaaaagacgaagcagcggctgcagaatgaggtcgaggacctcatgcttgatgtggagagg
acaaatgccgcctgtgccgcccttgacaaaaagcaaaggaacttcgataagatcctggca
gaatggaaacagaaatgtgaggaaacgcatgctgagcttgaggcctcccagaaggaggcc
cgttcccttggcactgagctgttcaagataaagaatgcctatgaggaatctttggatcag
ctagaaaccctgaagcgagagaacaaaaacttacagcaggagatttctgacctcacggaa
cagattgcagaaggagggaaacgtatccatgaactggagaaaataaagaaacaagtggaa
caagaaaagtgtgaacttcaggctgctttagaagaagcagaggcatctcttgaacatgaa
gagggaaagatcctgcgcatccagcttgagttgaaccaagtcaagtctgaggttgatagg
aaaattgctgaaaaagatgaggaaattgaccagctgaagagaaaccacattagaatcgtg
gagtccatgcagagcacgctggatgctgagatcaggagtaggaatgatgccattaggctc
aagaagaagatggagggagacctcaatgaaatggaaatccagctgaaccatgccaaccgc
atggctgctgaggccctgaggaactacaggaacacccaaggcatcctcaaggatacccag
atccacctggatgatgctctccggagccaggaggacctgaaggaacagctggccatggtg
gagcgcagagccaacctgctgcaggctgagatcgaggagctgcgggccactctggaacag
acagagaggagcagaaaaatcgcagaacaggagctcctggatgccagtgagcgtgttcag
ctactgcacacccagaacaccagcctgatcaacaccaagaagaagctggagacagatatt
tcccaaatgcaaggagagatggaggacattctccaggaagcccgcaatgcagaagaaaag
gccaagaaggccatcactgatgccgccatgatggctgaggagctgaagaaggagcaggac
accagcgcccacctggagcggatgaagaagaacatggagcagaccgtgaaggatctgcag
ctccgtctggatgaggctgagcagctggccctgaagggtgggaagaagcagatccagaaa
ctggaggccagggtacgggagctggaaggagaggttgagagtgagcaaaagcgtaatgct
gaggctgtcaaaggtctgcgcaaacatgagaggcgagtgaaggaactcacttaccagacg
gaagaagatagaaagaatattctcaggcttcaagatttggtagataaacttcaggcaaaa
gtgaaatcttataagagacaagctgaggaggctgaggaacaatccaacaccaatctagct
aaattccgcaagctccagcatgagctggaggaggccgaggaacgggctgacattgctgag
tcccaggtgaacaaactgcgggtgaagagccgggaggttcacacaaaagtcataagtgaa
gagtga

DBGET integrated database retrieval system