KEGG   Homo sapiens (human): 4621Help
Entry
4621              CDS       T01001                                 

Gene name
MYH3, DA2A, DA2B, DA8, HEMHC, MYHC-EMB, MYHSE1, SMHCE
Definition
(RefSeq) myosin heavy chain 3
  KO
K10352  
myosin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Disease
H00811  
Distal arthrogryposis (DA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    4621 (MYH3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4621 (MYH3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   4621 (MYH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P11055(Tbio)
UniProt: 
Position
17p13.1
AA seq 1940 aa AA seqDB search
MSSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKV
TVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEPAVLYNLKDRYTSWMIYTYSG
LFCVTVNPYKWLPVYNPEVVEGYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFATIAATGDLAKKKDSKMKGTLEDQIISANPLLEAFGNAKTVRND
NSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQILSNKKPELIE
LLLITTNPYDYPFISQGEILVASIDDAEELLATDSAIDILGFTPEEKSGLYKLTGAVMHY
GNMKFKQKQREEQAEPDGTEVADKTAYLMGLNSSDLLKALCFPRVKVGNEYVTKGQTVDQ
VHHAVNALSKSVYEKLFLWMVTRINQQLDTKLPRQHFIGVLDIAGFEIFEYNSLEQLCIN
FTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEECM
FPKATDTSFKNKLYDQHLGKSNNFQKPKVVKGRAEAHFSLIHYAGTVDYSVSGWLEKNKD
PLNETVVGLYQKSSNRLLAHLYATFATADADSGKKKVAKKKGSSFQTVSALFRENLNKLM
SNLRTTHPHFVRCIIPNETKTPGAMEHSLVLHQLRCNGVLEGIRICRKGFPNRILYGDFK
QRYRVLNASAIPEGQFIDSKKACEKLLASIDIDHTQYKFGHTKVFFKAGLLGTLEEMRDD
RLAKLITRTQAVCRGFLMRVEFQKMVQRRESIFCIQYNIRSFMNVKHWPWMKLFFKIKPL
LKSAETEKEMATMKEEFQKTKDELAKSEAKRKELEEKLVTLVQEKNDLQLQVQAESENLL
DAEERCDQLIKAKFQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDDLEL
TLAKVEKEKHATENKVKNLTEELSGLDETIAKLTREKKALQEAHQQALDDLQAEEDKVNS
LNKTKSKLEQQVEDLESSLEQEKKLRVDLERNKRKLEGDLKLAQESILDLENDKQQLDER
LKKKDFEYCQLQSKVEDEQTLGLQFQKKIKELQARIEELEEEIEAERATRAKTEKQRSDY
ARELEELSERLEEAGGVTSTQIELNKKREAEFLKLRRDLEEATLQHEAMVAALRKKHADS
VAELGEQIDNLQRVKQKLEKEKSEFKLEIDDLSSSMESVSKSKANLEKICRTLEDQLSEA
RGKNEEIQRSLSELTTQKSRLQTEAGELSRQLEEKESIVSQLSRSKQAFTQQTEELKRQL
EEENKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYETDA
IQRTEELEEAKKKLAQRLQDSEEQVEAVNAKCASLEKTKQRLQGEVEDLMVDVERANSLA
AALDKKQRNFDKVLAEWKTKCEESQAELEASLKESRSLSTELFKLKNAYEEALDQLETVK
RENKNLEQEIADLTEQIAENGKTIHELEKSRKQIELEKADIQLALEEAEAALEHEEAKIL
RIQLELTQVKSEIDRKIAEKDEEIEQLKRNYQRTVETMQSALDAEVRSRNEAIRLKKKME
GDLNEIEIQLSHANRQAAETLKHLRSVQGQLKDTQLHLDDALRGQEDLKEQLAIVERRAN
LLQAEVEELRATLEQTERARKLAEQELLDSNERVQLLHTQNTSLIHTKKKLETDLMQLQS
EVEDASRDARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDE
AEQLALKGGKKQIQKLETRIRELEFELEGEQKKNTESVKGLRKYERRVKELTYQSEEDRK
NVLRLQDLVDKLQVKVKSYKRQAEEADEQANAHLTKFRKAQHELEEAEERADIAESQVNK
LRAKTRDFTSSRMVVHESEE
NT seq 5823 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgacactgaaatggaagtgttcggcatagctgctcctttcctccggaagtca
gaaaaggagaggatcgaggctcagaaccagccctttgatgccaagacgtattgcttcgtg
gtggactcaaaggaagaatatgccaaggggaaaatcaagagttctcaggatgggaaggtc
actgtggaaactgaggacaacaggaccctggtggtcaaaccagaggatgtgtacgccatg
aacccccccaagttcgacaggatcgaagacatggccatgctgacgcacctgaatgagcca
gccgtgctgtacaacctgaaggaccgttacacatcttggatgatctatacctactcaggc
ctcttctgtgtcactgtcaacccctacaagtggctgccggtgtacaaccccgaggtggtg
gaaggctaccgaggcaaaaagcgccaggaggccccaccccacatcttctccatctctgac
aacgcctatcagttcatgctgactgatcgtgaaaaccagtccattctgatcaccggagaa
tccggggcaggaaagactgtgaacaccaaacgggtcatccagtactttgcaacaattgca
gctactggggacctggccaagaagaaggactccaaaatgaaggggactctggaagatcaa
atcatcagtgccaatcccctgctggaggcctttgggaacgccaagactgtgaggaatgac
aactcctcccgttttggcaagttcatccgaatccattttggaaccactgggaagctggcc
tctgcagatattgaaacttatcttctggaaaaatcaagagtcactttccagctgaaggct
gaaagaagctaccacatcttctaccagattctttctaacaagaagcctgagctcatagag
ctgctgcttattacgaccaacccttacgactacccgttcattagccagggggagatcctg
gtggccagcatagatgatgcagaggagctgctggctacagacagcgccattgacatcctg
ggcttcaccccagaagagaaatctgggctctacaagctgacgggagccgtgatgcactac
gggaacatgaagttcaagcagaagcagcgagaggagcaggccgagccggatggcacagaa
gtggctgacaaaacagcctatctgatgggcctgaactcttcggacctcctaaaagctttg
tgctttcctagagtgaaagttgggaatgagtacgttaccaaaggtcaaactgtggatcag
gttcaccatgctgtgaatgctctttcaaaatcagtttatgaaaagttgttcttgtggatg
gtcactcgcattaaccagcaactggatacgaagcttccaagacaacacttcattggtgtt
ttggacattgcaggctttgaaatctttgagtataacagcctggagcagctgtgcatcaac
ttcaccaatgagaaactgcaacagtttttcaaccaccacatgttcgtgctggagcaggag
gagtacaagaaggaaggcatcgagtggacgttcattgacttcgggatggacctggctgcc
tgcatcgagctcatcgagaagcctatgggcatcttctccatcctggaagaggagtgcatg
ttccccaaggcaacagacacctccttcaagaacaagctgtatgaccagcatcttggaaag
tccaacaacttccagaagcccaaggtggtcaaaggcagggccgaggctcacttctcactg
atccactatgcgggcaccgtggactacagtgtctcaggttggctggagaagaacaaggac
cctctgaacgagactgtggttgggctgtaccagaagtcttccaacaggctcctggcacac
ctctatgccacgtttgccacggcggatgctgacagtggaaagaagaaagttgccaagaag
aagggttcttccttccaaactgtctctgcccttttcagggaaaacctgaacaagctgatg
tcaaatttaagaactactcaccctcattttgtgcgttgtataattcccaatgaaaccaaa
actccaggggctatggaacacagccttgttctgcaccagctgcggtgtaacggtgtcctg
gagggcatccgcatctgcaggaaagggttcccaaacaggattctctatggcgattttaaa
caaagataccgagtgctgaatgccagtgcaatccctgagggacaattcattgacagcaag
aaagcctgtgaaaagcttctggcatccattgatattgaccacactcagtacaaatttgga
cataccaaggtgttcttcaaggctggcttgctgggaaccctggaagagatgcgggatgac
cgcctggccaaactaatcacccggacacaagctgtgtgcagagggttcctcatgcgtgtg
gaattccagaagatggtgcagaggagggagtccatcttctgcatccagtacaacattcgc
tcattcatgaacgtcaagcactggccctggatgaaactcttcttcaagatcaagcccctc
ctcaagagtgcagagactgagaaagagatggccaccatgaaggaagaattccagaaaacc
aaagatgaactcgccaagtcggaggcaaaaaggaaggagctagaggaaaaactggtgact
ctggtccaagagaagaatgacctgcagctccaagtacaagctgaaagcgaaaatttgttg
gatgctgaggaaagatgcgatcagctgatcaaagccaaattccagctcgaggccaagatc
aaggaggtgacagagagagctgaagatgaggaggagatcaatgctgagctgacggccaag
aagaggaaactggaggatgaatgctcagagctcaagaaagacattgatgaccttgagttg
accctggccaaggttgagaaggagaagcatgccacagagaacaaggttaaaaaccttact
gaggaactctctgggttagatgaaacaattgcaaagttaaccagagagaagaaggccctc
caagaggcgcaccagcaggccttggatgacctccaagctgaagaagacaaagtcaattct
ttgaacaaaaccaagagcaaactggaacagcaagtggaagacctggaaagctccctagaa
caagaaaagaagctccgagtagacctggaaaggaacaaaaggaaattggaaggagacttg
aagcttgctcaagagtccatattagatctggagaatgacaagcaacagctggacgaaagg
ctcaagaagaaagattttgaatattgtcaacttcaaagcaaagtggaagatgagcagaca
ctgggcctccagtttcagaagaaaatcaaagagttgcaggctcgaattgaggagctggaa
gaggagatagaggcggagagggccacccgcgcgaagacagagaaacagcgcagcgactat
gcccgggagctggaggagctgagcgagcggctggaggaggcgggaggcgtcacctccacg
cagatagagctcaacaagaagcgggaggcggagttcctgaagctgcgcagggacctggag
gaggccacactgcagcacgaagccatggtggccgcgctgaggaagaagcatgcggatagt
gtggccgagcttggggagcagattgacaacctgcagcgggtcaagcagaagctggagaag
gagaagagcgagttcaagctggagatcgatgacctctccagcagcatggagagtgtgtcg
aaatctaaggcaaatctggaaaaaatctgccgaaccctggaggatcagttaagtgaggcc
aggggcaagaatgaggaaattcagaggagcctgagcgagctgaccacacagaagtctcgt
ttgcagaccgaggctggtgagctgagtcgtcagctggaagaaaaagaaagcatagtatcc
caactttccaggagcaagcaagcctttacccagcaaacagaagagctcaagaggcagctg
gaggaagagaacaaggccaagaacgccctggcgcacgccctgcagtcctcccgccacgac
tgtgacctgctgcgggaacagtatgaggaggagcaggaaggcaaagctgagctgcagagg
gcgctgtccaaggccaatagtgaggttgcccagtggagaaccaaatacgagacggacgcc
atccagcgcacagaagagctggaggaggccaagaaaaaacttgctcagcgccttcaagat
tccgaggaacaggttgaggcagtgaatgctaaatgtgcttcactggagaagaccaagcag
aggctgcaaggagaggtggaggatctgatggttgatgttgaaagagccaattccttggcc
gccgctctggacaagaagcagaggaactttgacaaggtgttggcagagtggaagacaaag
tgtgaggagagccaagcagagctggaggcatccctgaaggagtcccgctccttgagcact
gagctcttcaaactgaaaaatgcctacgaggaagccttagatcaacttgaaactgtgaaa
cgggaaaataagaacttagagcaggagatagcagatctcacagaacaaattgctgaaaat
ggcaaaaccatccatgaactggagaaatcaagaaagcagattgagctggaaaaggctgat
atccagctggctctcgaggaagcagaggctgctcttgagcatgaagaagccaagatcctc
cgaatccagcttgaattgacacaagtgaaatcagaaattgatagaaagatcgccgagaag
gatgaagagatcgagcagctgaagaggaactaccagagaacagtggaaaccatgcagagc
gccctggacgccgaggtgcggagcaggaatgaagccatccggctcaagaagaagatggag
ggggacctgaatgaaatcgagatccagctgagccacgccaaccgccaggcggcggagacc
ctcaaacacctcaggagtgtccagggacagctgaaggatacgcagctccacctggatgat
gccctccggggccaggaggacctgaaggagcagctggcgattgtggagcgcagagccaac
ctgctgcaggccgaggtggaggagctgcgggctactctggagcagacggagagggcccgg
aaactggcggaacaggagctcctggactccaacgagagggtgcagctgctgcatacccag
aacaccagcctcatccacaccaagaagaagctggagacagacctcatgcagctccagagt
gaggtagaagatgccagcagggatgcaaggaacgctgaggagaaggccaagaaggccatc
acggacgctgccatgatggcggaggagctgaagaaggagcaggacaccagcgcccacctt
gagcggatgaagaagaacctggaacagacggtgaaggacctgcagcatcgtctagatgag
gccgagcagctggcgctgaagggcgggaagaagcagatccagaaactggagaccaggatc
cgagagctggagtttgaacttgagggagagcagaagaagaacacagagtctgttaagggc
ctgaggaagtatgagcggagggtcaaggagctgacgtaccagagtgaagaggacaggaag
aatgtgctgagattgcaggatctggtggataaactgcaagtgaaagtcaagtcctacaag
aggcaggcggaggaggctgatgaacaagccaatgctcatctcaccaaattccgaaaggct
cagcatgagctggaggaggccgaggaacgtgcggatatcgcagaatctcaagtcaacaag
ctccgcgctaagactcgagacttcacctccagcaggatggtggtccacgagagtgaagag
tga

DBGET integrated database retrieval system