KEGG   Homo sapiens (human): 4621Help
Entry
4621              CDS       T01001                                 

Gene name
MYH3, HEMHC, MYHC-EMB, MYHSE1, SMHCE
Definition
myosin, heavy chain 3, skeletal muscle, embryonic
Orthology
K10352  
myosin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Disease
H00811  
Distal arthrogryposis (DA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell communication
   04530 Tight junction
    4621 (MYH3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   4621 (MYH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 1940 aa AA seqDB search
MSSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKV
TVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEPAVLYNLKDRYTSWMIYTYSG
LFCVTVNPYKWLPVYNPEVVEGYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFATIAATGDLAKKKDSKMKGTLEDQIISANPLLEAFGNAKTVRND
NSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQILSNKKPELIE
LLLITTNPYDYPFISQGEILVASIDDAEELLATDSAIDILGFTPEEKSGLYKLTGAVMHY
GNMKFKQKQREEQAEPDGTEVADKTAYLMGLNSSDLLKALCFPRVKVGNEYVTKGQTVDQ
VHHAVNALSKSVYEKLFLWMVTRINQQLDTKLPRQHFIGVLDIAGFEIFEYNSLEQLCIN
FTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEECM
FPKATDTSFKNKLYDQHLGKSNNFQKPKVVKGRAEAHFSLIHYAGTVDYSVSGWLEKNKD
PLNETVVGLYQKSSNRLLAHLYATFATADADSGKKKVAKKKGSSFQTVSALFRENLNKLM
SNLRTTHPHFVRCIIPNETKTPGAMEHSLVLHQLRCNGVLEGIRICRKGFPNRILYGDFK
QRYRVLNASAIPEGQFIDSKKACEKLLASIDIDHTQYKFGHTKVFFKAGLLGTLEEMRDD
RLAKLITRTQAVCRGFLMRVEFQKMVQRRESIFCIQYNIRSFMNVKHWPWMKLFFKIKPL
LKSAETEKEMATMKEEFQKTKDELAKSEAKRKELEEKLVTLVQEKNDLQLQVQAESENLL
DAEERCDQLIKAKFQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDDLEL
TLAKVEKEKHATENKVKNLTEELSGLDETIAKLTREKKALQEAHQQALDDLQAEEDKVNS
LNKTKSKLEQQVEDLESSLEQEKKLRVDLERNKRKLEGDLKLAQESILDLENDKQQLDER
LKKKDFEYCQLQSKVEDEQTLGLQFQKKIKELQARIEELEEEIEAERATRAKTEKQRSDY
ARELEELSERLEEAGGVTSTQIELNKKREAEFLKLRRDLEEATLQHEAMVAALRKKHADS
VAELGEQIDNLQRVKQKLEKEKSEFKLEIDDLSSSMESVSKSKANLEKICRTLEDQLSEA
RGKNEEIQRSLSELTTQKSRLQTEAGELSRQLEEKESIVSQLSRSKQAFTQQTEELKRQL
EEENKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYETDA
IQRTEELEEAKKKLAQRLQDSEEQVEAVNAKCASLEKTKQRLQGEVEDLMVDVERANSLA
AALDKKQRNFDKVLAEWKTKCEESQAELEASLKESRSLSTELFKLKNAYEEALDQLETVK
RENKNLEQEIADLTEQIAENGKTIHELEKSRKQIELEKADIQLALEEAEAALEHEEAKIL
RIQLELTQVKSEIDRKIAEKDEEIEQLKRNYQRTVETMQSALDAEVRSRNEAIRLKKKME
GDLNEIEIQLSHANRQAAETLKHLRSVQGQLKDTQLHLDDALRGQEDLKEQLAIVERRAN
LLQAEVEELRATLEQTERARKLAEQELLDSNERVQLLHTQNTSLIHTKKKLETDLMQLQS
EVEDASRDARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDE
AEQLALKGGKKQIQKLETRIRELEFELEGEQKKNTESVKGLRKYERRVKELTYQSEEDRK
NVLRLQDLVDKLQVKVKSYKRQAEEADEQANAHLTKFRKAQHELEEAEERADIAESQVNK
LRAKTRDFTSSRMVVHESEE
NT seq 5823 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgacactgaaatggaagtgttcggcatagctgctcctttcctccggaagtca
gaaaaggagaggatcgaggctcagaaccagccctttgatgccaagacgtattgcttcgtg
gtggactcaaaggaagaatatgccaaggggaaaatcaagagttctcaggatgggaaggtc
actgtggaaactgaggacaacaggaccctggtggtcaaaccagaggatgtgtacgccatg
aacccccccaagttcgacaggatcgaagacatggccatgctgacgcacctgaatgagcca
gccgtgctgtacaacctgaaggaccgttacacatcttggatgatctatacctactcaggc
ctcttctgtgtcactgtcaacccctacaagtggctgccggtgtacaaccccgaggtggtg
gaaggctaccgaggcaaaaagcgccaggaggccccaccccacatcttctccatctctgac
aacgcctatcagttcatgctgactgatcgtgaaaaccagtccattctgatcaccggagaa
tccggggcaggaaagactgtgaacaccaaacgggtcatccagtactttgcaacaattgca
gctactggggacctggccaagaagaaggactccaaaatgaaggggactctggaagatcaa
atcatcagtgccaatcccctgctggaggcctttgggaacgccaagactgtgaggaatgac
aactcctcccgttttggcaagttcatccgaatccattttggaaccactgggaagctggcc
tctgcagatattgaaacttatcttctggaaaaatcaagagtcactttccagctgaaggct
gaaagaagctaccacatcttctaccagattctttctaacaagaagcctgagctcatagag
ctgctgcttattacgaccaacccttacgactacccgttcattagccagggggagatcctg
gtggccagcatagatgatgcagaggagctgctggctacagacagcgccattgacatcctg
ggcttcaccccagaagagaaatctgggctctacaagctgacgggagccgtgatgcactac
gggaacatgaagttcaagcagaagcagcgagaggagcaggccgagccggatggcacagaa
gtggctgacaaaacagcctatctgatgggcctgaactcttcggacctcctaaaagctttg
tgctttcctagagtgaaagttgggaatgagtacgttaccaaaggtcaaactgtggatcag
gttcaccatgctgtgaatgctctttcaaaatcagtttatgaaaagttgttcttgtggatg
gtcactcgcattaaccagcaactggatacgaagcttccaagacaacacttcattggtgtt
ttggacattgcaggctttgaaatctttgagtataacagcctggagcagctgtgcatcaac
ttcaccaatgagaaactgcaacagtttttcaaccaccacatgttcgtgctggagcaggag
gagtacaagaaggaaggcatcgagtggacgttcattgacttcgggatggacctggctgcc
tgcatcgagctcatcgagaagcctatgggcatcttctccatcctggaagaggagtgcatg
ttccccaaggcaacagacacctccttcaagaacaagctgtatgaccagcatcttggaaag
tccaacaacttccagaagcccaaggtggtcaaaggcagggccgaggctcacttctcactg
atccactatgcgggcaccgtggactacagtgtctcaggttggctggagaagaacaaggac
cctctgaacgagactgtggttgggctgtaccagaagtcttccaacaggctcctggcacac
ctctatgccacgtttgccacggcggatgctgacagtggaaagaagaaagttgccaagaag
aagggttcttccttccaaactgtctctgcccttttcagggaaaacctgaacaagctgatg
tcaaatttaagaactactcaccctcattttgtgcgttgtataattcccaatgaaaccaaa
actccaggggctatggaacacagccttgttctgcaccagctgcggtgtaacggtgtcctg
gagggcatccgcatctgcaggaaagggttcccaaacaggattctctatggcgattttaaa
caaagataccgagtgctgaatgccagtgcaatccctgagggacaattcattgacagcaag
aaagcctgtgaaaagcttctggcatccattgatattgaccacactcagtacaaatttgga
cataccaaggtgttcttcaaggctggcttgctgggaaccctggaagagatgcgggatgac
cgcctggccaaactaatcacccggacacaagctgtgtgcagagggttcctcatgcgtgtg
gaattccagaagatggtgcagaggagggagtccatcttctgcatccagtacaacattcgc
tcattcatgaacgtcaagcactggccctggatgaaactcttcttcaagatcaagcccctc
ctcaagagtgcagagactgagaaagagatggccaccatgaaggaagaattccagaaaacc
aaagatgaactcgccaagtcggaggcaaaaaggaaggagctagaggaaaaactggtgact
ctggtccaagagaagaatgacctgcagctccaagtacaagctgaaagcgaaaatttgttg
gatgctgaggaaagatgcgatcagctgatcaaagccaaattccagctcgaggccaagatc
aaggaggtgacagagagagctgaagatgaggaggagatcaatgctgagctgacggccaag
aagaggaaactggaggatgaatgctcagagctcaagaaagacattgatgaccttgagttg
accctggccaaggttgagaaggagaagcatgccacagagaacaaggttaaaaaccttact
gaggaactctctgggttagatgaaacaattgcaaagttaaccagagagaagaaggccctc
caagaggcgcaccagcaggccttggatgacctccaagctgaagaagacaaagtcaattct
ttgaacaaaaccaagagcaaactggaacagcaagtggaagacctggaaagctccctagaa
caagaaaagaagctccgagtagacctggaaaggaacaaaaggaaattggaaggagacttg
aagcttgctcaagagtccatattagatctggagaatgacaagcaacagctggacgaaagg
ctcaagaagaaagattttgaatattgtcaacttcaaagcaaagtggaagatgagcagaca
ctgggcctccagtttcagaagaaaatcaaagagttgcaggctcgaattgaggagctggaa
gaggagatagaggcggagagggccacccgcgcgaagacagagaaacagcgcagcgactat
gcccgggagctggaggagctgagcgagcggctggaggaggcgggaggcgtcacctccacg
cagatagagctcaacaagaagcgggaggcggagttcctgaagctgcgcagggacctggag
gaggccacactgcagcacgaagccatggtggccgcgctgaggaagaagcatgcggatagt
gtggccgagcttggggagcagattgacaacctgcagcgggtcaagcagaagctggagaag
gagaagagcgagttcaagctggagatcgatgacctctccagcagcatggagagtgtgtcg
aaatctaaggcaaatctggaaaaaatctgccgaaccctggaggatcagttaagtgaggcc
aggggcaagaatgaggaaattcagaggagcctgagcgagctgaccacacagaagtctcgt
ttgcagaccgaggctggtgagctgagtcgtcagctggaagaaaaagaaagcatagtatcc
caactttccaggagcaagcaagcctttacccagcaaacagaagagctcaagaggcagctg
gaggaagagaacaaggccaagaacgccctggcgcacgccctgcagtcctcccgccacgac
tgtgacctgctgcgggaacagtatgaggaggagcaggaaggcaaagctgagctgcagagg
gcgctgtccaaggccaatagtgaggttgcccagtggagaaccaaatacgagacggacgcc
atccagcgcacagaagagctggaggaggccaagaaaaaacttgctcagcgccttcaagat
tccgaggaacaggttgaggcagtgaatgctaaatgtgcttcactggagaagaccaagcag
aggctgcaaggagaggtggaggatctgatggttgatgttgaaagagccaattccttggcc
gccgctctggacaagaagcagaggaactttgacaaggtgttggcagagtggaagacaaag
tgtgaggagagccaagcagagctggaggcatccctgaaggagtcccgctccttgagcact
gagctcttcaaactgaaaaatgcctacgaggaagccttagatcaacttgaaactgtgaaa
cgggaaaataagaacttagagcaggagatagcagatctcacagaacaaattgctgaaaat
ggcaaaaccatccatgaactggagaaatcaagaaagcagattgagctggaaaaggctgat
atccagctggctctcgaggaagcagaggctgctcttgagcatgaagaagccaagatcctc
cgaatccagcttgaattgacacaagtgaaatcagaaattgatagaaagatcgccgagaag
gatgaagagatcgagcagctgaagaggaactaccagagaacagtggaaaccatgcagagc
gccctggacgccgaggtgcggagcaggaatgaagccatccggctcaagaagaagatggag
ggggacctgaatgaaatcgagatccagctgagccacgccaaccgccaggcggcggagacc
ctcaaacacctcaggagtgtccagggacagctgaaggatacgcagctccacctggatgat
gccctccggggccaggaggacctgaaggagcagctggcgattgtggagcgcagagccaac
ctgctgcaggccgaggtggaggagctgcgggctactctggagcagacggagagggcccgg
aaactggcggaacaggagctcctggactccaacgagagggtgcagctgctgcatacccag
aacaccagcctcatccacaccaagaagaagctggagacagacctcatgcagctccagagt
gaggtagaagatgccagcagggatgcaaggaacgctgaggagaaggccaagaaggccatc
acggacgctgccatgatggcggaggagctgaagaaggagcaggacaccagcgcccacctt
gagcggatgaagaagaacctggaacagacggtgaaggacctgcagcatcgtctagatgag
gccgagcagctggcgctgaagggcgggaagaagcagatccagaaactggagaccaggatc
cgagagctggagtttgaacttgagggagagcagaagaagaacacagagtctgttaagggc
ctgaggaagtatgagcggagggtcaaggagctgacgtaccagagtgaagaggacaggaag
aatgtgctgagattgcaggatctggtggataaactgcaagtgaaagtcaagtcctacaag
aggcaggcggaggaggctgatgaacaagccaatgctcatctcaccaaattccgaaaggct
cagcatgagctggaggaggccgaggaacgtgcggatatcgcagaatctcaagtcaacaag
ctccgcgctaagactcgagacttcacctccagcaggatggtggtccacgagagtgaagag
tga

DBGET integrated database retrieval system