KEGG   Homo sapiens (human): 4622Help
Entry
4622              CDS       T01001                                 

Gene name
MYH4, MYH2B, MyHC-2B, MyHC-IIb
Definition
myosin, heavy chain 4, skeletal muscle
Orthology
K10352  
myosin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Class
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 1939 aa AA seqDB search
MSSDSEMAIFGEAAPFLRKSEKERIEAQNKPFDAKTSVFVVDPKESYVKAIVQSREGGKV
TAKTEAGATVTVKEDQVFSMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSG
LFCVTVNPYKWLPVYNPEVVTAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFATIAVTGEKKKEEPASGKMQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLKAERSYHIFYQILSNKKPEL
IEMLLITTNPYDFAFVSQGEITVPSIDDQEELMATDSAVDILGFTADEKVAIYKLTGAVM
HYGNMKFKQKQREEQAEPDGTEVADKAAYLTSLNSADLLKSLCYPRVKVGNEFVTKGQTV
QQVYNAVGALAKAIYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLC
INFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEE
CMFPKATDTSFKNKLYEQHLGKSNNFQKPKPAKGKPEAHFSLVHYAGTVDYNIAGWLDKN
KDPLNETVVGLYQKSAMKTLAFLFSGAQTAEAEGGGGKKGGKKKGSSFQTVSALFRENLN
KLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYA
DFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIEIDHTQYKFGHTKVFFKAGLLGTLEEM
RDEKLAQLITRTQAICRGFLMRVEFRKMMERRESIFCIQYNIRAFMNVKHWPWMKLYFKI
KPLLKSAETEKEMANMKEEFEKTKEELAKTEAKRKELEEKMVTLMQEKNDLQLQVQAEAD
ALADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDD
LELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKEKKALQEAHQQTLDDLQMEEDK
VNTLTKAKTKLEQQVDDLEGSLEQEKKLCMDLERAKRKLEGDLKLAQESTMDTENDKQQL
NEKLKKKEFEMSNLQGKIEDEQALAIQLQKKIKELQARIEELEEEIEAERASRAKAEKQR
SDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEESTLQHEATAAALRKKH
ADSVAELGEQIDSLQRVKQKLEKEKSELKMEINDLASNMETVSKAKANFEKMCRTLEDQL
SEIKTKEEEQQRLINELSAQKARLHTESGEFSRQLDEKDAMVSQLSRGKQAFTQQIEELK
RQLEEETKAKSTLAHALQSARHDCDLLREQYEEEQEAKAELQRGMSKANSEVAQWRTKYE
TDAIQRTEELEEAKKKLAQRLQDAEEHVEAVNSKCASLEKTKQRLQNEVEDLMIDVERSN
AACIALDKKQRNFDKVLAEWKQKYEETQAELEASQKESRSLSTELFKVKNAYEESLDHLE
TLKRENKNLQQEISDLTEQIAEGGKHIHELEKVKKQLDHEKSELQTSLEEAEASLEHEEG
KILRIQLELNQVKSEIDRKIAEKDEELDQLKRNHLRVVESMQSTLDAEIRSRNDALRIKK
KMEGDLNEMEIQLNHANRQAAEALRNLRNTQGILKDTQLHLDDAIRGQDDLKEQLAMVER
RANLMQAEVEELRASLERTERGRKMAEQELLDASERVQLLHTQNTSLINTKKKLETDISQ
IQGEMEDIVQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQLR
LDEAEQLALKGGKKQIQKLEARVRELESEVESEQKHNVEAVKGLRKHERRVKELTYQTEE
DRKNILRLQDLVDKLQTKVKAYKRQAEEAEEQSNVNLAKFRKLQHELEEAKERADIAESQ
VNKLRVKSREVHTKVISEE
NT seq 5820 nt NT seq  +upstreamnt  +downstreamnt
atgagttctgactctgagatggccatttttggggaggctgctcctttcctccgaaagtct
gaaaaggagcgaattgaagctcagaacaagccttttgatgccaagacatcagtctttgtg
gtggaccctaaggagtcctacgtgaaagcaatagtgcagagcagggaaggggggaaggtg
acagccaagaccgaagctggagctactgtaactgtgaaagaagaccaagtcttctccatg
aaccctcccaaatatgacaagatcgaggacatggccatgatgactcacctgcatgagcct
gctgtgctgtataacctcaaagagcgttacgcagcctggatgatctacacctactcgggc
ctcttctgtgtcaccgtcaacccctacaagtggctgccggtgtacaaccctgaggtggtg
acagcctaccgaggcaaaaagcgccaggaggccccaccccatatcttctccatctctgac
aatgcctatcagttcatgctaactgatcgtgaaaaccagtcaatcttgattactggagaa
tctggtgcagggaagactgtgaacacgaagcgtgtcatccagtactttgcaacaattgca
gttactggagagaagaaaaaagaggaacctgcctctggcaaaatgcaggggacccttgaa
gatcaaatcatcagtgctaaccccctactggaagccttcggcaatgccaagaccgtgagg
aatgacaactcctctcgctttggtaaattcatcaggatccattttggtgccacaggcaaa
ctggcttctgcagatattgaaacatatctgctagagaagtcccgagttacttttcagcta
aaggctgaaagaagctaccacatattttatcaaatcctgtccaataagaaaccagagctc
attgaaatgcttctgatcaccaccaacccatatgacttcgcatttgtcagccaaggggaa
attactgtgcccagcattgatgaccaggaagagctgatggccacagatagtgctgtggac
atcctgggtttcactgctgatgaaaaggtggccatttacaagctcactggagccgtgatg
cattatgggaacatgaaattcaagcaaaagcaaagggaagagcaggcagagccagatggc
acggaagttgctgacaaagctgcttatctgacaagtctgaactctgctgacctgctcaaa
tctctctgctatcccagagtcaaggtcggcaatgagttcgtaaccaaaggccagactgtg
cagcaggtgtacaatgcagtgggtgctctggccaaagccatctacgagaagatgttcctg
tggatggtcacccgcatcaaccagcagctggacaccaagcagcccaggcagtacttcatc
ggggtcttggacattgctggctttgagatctttgatttcaacagcctggagcagctgtgc
atcaacttcaccaacgagaaactgcaacagtttttcaaccaccacatgttcgtgctggag
caggaagagtacaagaaggaaggcatcgagtgggagttcattgacttcgggatggacctg
gctgcctgcatcgagctcatcgagaagcctatgggcatcttctccatcctagaagaggag
tgcatgttccccaaggcaacagacacctccttcaagaacaagctgtatgaacaacatctt
ggaaaatccaacaacttccagaagcccaagcctgccaaaggcaagcctgaggctcacttc
tcactggtgcactatgccggcaccgtggactacaacatcgccggctggctggacaaaaac
aaggaccccctgaatgagactgtggtggggctgtaccagaagtctgcaatgaagactctg
gctttcctcttctctggggcacaaactgctgaagcagagggtggtggtggaaagaaaggt
ggcaaaaagaagggttcttctttccagacagtgtcagctcttttcagggagaatttgaat
aagctgatgaccaacttgaggagcactcacccccactttgtgcggtgcatcatccccaat
gaaactaaaactcctggtgccatggagcatgagcttgtcctgcatcagctgaggtgtaac
ggtgtgctggaaggcatccgcatctgcaggaaaggcttcccaagcagaatcctttatgca
gacttcaaacagagatacaaggttctaaatgcgagtgctatcccagagggtcagttcatt
gacagcaagaaggcttctgagaaacttctagggtctattgaaattgaccacacccagtac
aaattcggtcataccaaggttttcttcaaagctggcctgctgggaactctagaggaaatg
cgagatgaaaagctagctcaactcatcacgcgcactcaagccatatgcagagggttcctg
atgagagtggagttcagaaagatgatggagaggagagagtccatcttctgcattcagtac
aacatccgtgctttcatgaatgtgaagcactggccctggatgaagctgtatttcaagatc
aagcccctcctcaagagtgcagagacagagaaggagatggccaacatgaaggaagaattt
gagaaaaccaaagaagagctggctaagacagaggcaaaaaggaaagaactagaagaaaag
atggtgacgctaatgcaagagaaaaatgacttacaactccaagttcaagctgaagcagat
gccttggctgatgcagaggaaagatgtgatcagttgattaaaaccaaaatccaacttgag
gccaaaatcaaagaggtaactgaaagagctgaggatgaggaagagatcaatgctgagctg
acagccaagaagaggaaactggaggatgaatgttcagagctcaagaaagacattgatgac
cttgagctgacactggccaaggttgagaaggagaaacatgccacagagaacaaggtgaaa
aacctcacagaagagatggcaggtctggatgaaaccattgctaagctgaccaaggagaag
aaggctctccaggaggcccaccagcagaccctggatgacctgcagatggaggaggacaaa
gtcaacaccctgaccaaagctaaaaccaagctagaacagcaagtggacgatcttgaagga
tctctggaacaagaaaagaaactttgcatggacttagaaagagccaagagaaaactggag
ggtgacctaaaattggcccaagaatccacaatggatacagaaaatgacaaacagcaactt
aatgagaaactcaaaaagaaagagtttgaaatgagcaatctgcaaggcaagattgaagat
gaacaagcccttgcaatacagctacaaaagaagatcaaagaattacaggcccgcattgag
gagctggaggaggaaatcgaggcagagcgggcctcccgggccaaagcagagaagcagcgc
tctgacctctcccgggagctggaggagatcagtgagaggctggaagaagccggtggggcc
acttcagcccagattgagatgaacaagaagcgggaggctgagttccagaaaatgcgcagg
gacctggaagagtccaccctgcagcacgaagccacggcagctgctcttcggaagaagcac
gcagatagtgtggctgagcttggggagcagattgacagccttcagcgggtcaagcagaag
ctggagaaggaaaagagtgagctgaagatggagatcaatgaccttgctagtaacatggag
actgtctccaaagccaaggcaaactttgagaaaatgtgccgcaccctagaggaccagctt
agtgaaataaaaacaaaggaagaagagcaacaacgcttaataaatgagttgtcagcccag
aaggcacgtttacacacagaatcaggtgagttttcacgacagctagatgaaaaagatgct
atggtttctcagctatcccgaggcaaacaagcatttacacaacagattgaagaattaaag
aggcagctagaagaggagactaaggccaagagcactctggcccatgccctgcagtcagcc
cgccatgactgtgacctgctgcgggaacagtatgaggaggagcaggaagccaaggctgag
ctgcagaggggaatgtccaaggccaacagtgaggttgcccagtggaggaccaagtacgag
acggacgccatccagcgcacagaggagctggaggaggccaagaagaagctagcccagcgt
ctgcaggatgcagaagaacatgtagaagctgtgaattccaaatgtgcttctcttgaaaag
acaaagcagaggctacagaatgaagtagaggacctcatgattgatgtggaacgatctaat
gctgcctgcatagctctcgataagaagcaaagaaactttgacaaggttctggcagaatgg
aaacagaagtatgaggaaactcaggctgaacttgaggcctcccagaaggagtcgcgttct
ctcagcactgagctgttcaaggtgaagaatgcctacgaggaatccctggatcatcttgaa
actctaaagcgagagaataagaacttacaacaggagatttctgacctgacagagcaaatt
gcagagggtggaaagcatatccatgaactggagaaagtaaagaaacaacttgatcatgag
aagagtgaactacagacttccctagaggaagcagaggcatctcttgagcatgaagaaggc
aaaattcttcgcattcaacttgagctaaatcaggtgaaatctgagattgaccgaaaaatt
gctgaaaaagatgaagaactcgatcagctaaagaggaaccatctcagagttgtggagtca
atgcagagtacactggatgctgagatcaggagcagaaatgatgctctgaggatcaagaag
aagatggagggagatcttaatgaaatggaaatccagctgaaccatgccaaccgccaggct
gctgaggcactaaggaatcttagaaacacacaaggaatactgaaggacactcagctacat
ttggatgatgccatcagaggccaagatgaccttaaggaacaactggcaatggttgagcgc
agagctaacctgatgcaggctgaagttgaagagctcagggcatccctggaacggactgag
agaggcaggaaaatggcagagcaagagcttctggatgccagtgaacgtgtgcaacttctg
cacactcagaacaccagcctgatcaacaccaagaagaagctggaaacagacatttcccaa
atccagggagagatggaggacatcgtccaggaagcccgcaatgcagaggagaaggccaag
aaggccatcactgatgctgccatgatggctgaggagctgaagaaggaacaggacaccagc
gcccacctggagcggatgaagaagaacatggagcagaccgtgaaggatctgcagctccgt
ctggatgaggctgagcagctggcgctgaagggtgggaagaagcagatccagaaactggag
gccagggtgagagagcttgaaagtgaggtggaaagtgaacagaagcacaatgttgaggct
gtcaagggtcttcgcaaacatgagagaagagtgaaggaactcacttaccagactgaggag
gaccgcaagaatattctcaggctgcaggacttggtggacaaattgcaaaccaaagtcaaa
gcttacaagagacaagctgaagaggctgaggaacaatccaatgtcaaccttgccaagttc
cgcaagctccagcacgagctggaggaggccaaggaacgggctgacattgctgagtcccaa
gtcaacaagctgagagtgaagagtcgggaggttcacacaaaagtcataagtgaagagtaa

DBGET integrated database retrieval system