KEGG   Homo sapiens (human): 4626Help
Entry
4626              CDS       T01001                                 

Gene name
MYH8, MyHC-peri, MyHC-pn, gtMHC-F
Definition
myosin, heavy chain 8, skeletal muscle, perinatal
Orthology
K10352  
myosin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Disease
H00811  
Distal arthrogryposis (DA)
H00872  
Trismus-pseudocamptodactyly syndrome
Class
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 1937 aa AA seqDB search
MSASSDAEMAVFGEAAPYLRKSEKERIEAQNKPFDAKTSVFVAEPKESYVKSTIQSKEGG
KVTVKTEGGATLTVREDQVFPMNPPKYDKIEDMAMMTHLHEPGVLYNLKERYAAWMIYTY
SGLFCVTVNPYKWLPVYKPEVVAAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILIT
GESGAGKTVNTKRVIQYFATIAVTGEKKKDESGKMQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQITSNKKPDL
IEMLLITTNPYDYAFVSQGEITVPSIDDQEELMATDSAIDILGFTPEEKVSIYKLTGAVM
HYGNMKFKQKQREEQAEPDGTEVADKAAYLQSLNSADLLKALCYPRVKVGNEYVTKGQTV
QQVYNAVGALAKAVYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLC
INFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPLGIFSILEEE
CMFPKATDTSFKNKLYDQHLGKSANFQKPKVVKGKAEAHFSLIHYAGTVDYNITGWLDKN
KDPLNDTVVGLYQKSAMKTLASLFSTYASAEADSSAKKGAKKKGSSFQTVSALFRENLNK
LMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYGD
FKQRYKVLNASAIPEGQFIDSKKASEKLLASIDIDHTQYKFGHTKVFFKAGLLGLLEEMR
DEKLAQIITRTQAVCRGFLMRVEYQKMLQRREALFCIQYNVRAFMNVKHWPWMKLFFKIK
PLLKSAETEKEMATMKEEFQKTKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQSEADS
LADAEERCEQLIKNKIQLEAKIKEVTERAEEEEEINAELTAKKRKLEDECSELKKDIDDL
ELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLSKEKKALQETHQQTLDDLQAEEDKV
NILTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESTMDMENDKQQLD
EKLEKKEFEISNLISKIEDEQAVEIQLQKKIKELQARIEELGEEIEAERASRAKAEKQRS
DLSRELEEISERLEEAGGATSAQVELNKKREAEFQKLRRDLEEATLQHEAMVAALRKKHA
DSMAELGEQIDNLQRVKQKLEKEKSELKMETDDLSSNAEAISKAKGNLEKMCRSLEDQVS
ELKTKEEEQQRLINDLTAQRARLQTEAGEYSRQLDEKDALVSQLSRSKQASTQQIEELKH
QLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYET
DAIQRTEELEEAKKKLAQRLQEAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERSNA
ACAALDKKQRNFDKVLSEWKQKYEETQAELEASQKESRSLSTELFKVKNVYEESLDQLET
LRRENKNLQQEISDLTEQIAEGGKQIHELEKIKKQVEQEKCEIQAALEEAEASLEHEEGK
ILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHTRVVETMQSTLDAEIRSRNDALRVKKK
MEGDLNEMEIQLNHANRLAAESLRNYRNTQGILKETQLHLDDALRGQEDLKEQLAIVERR
ANLLQAEIEELWATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLENDVSQL
QSEVEEVIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRL
DEAEQLALKGGKKQIQKLEARVRELEGEVENEQKRNAEAVKGLRKHERRVKELTYQTEED
RKNVLRLQDLVDKLQAKVKSYKRQAEEAEEQSNANLSKFRKLQHELEEAEERADIAESQV
NKLRVKSREVHTKISAE
NT seq 5814 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgagctcagacgctgagatggctgtttttggcgaagctgctccctaccttcga
aaatcagaaaaggagcggattgaggcccaaaacaagccgtttgatgctaaaacatctgtc
tttgtggcggagcccaaggaatcctatgtgaagagcactatacaaagcaaagaaggaggg
aaagtaaccgtaaagactgaaggtggagcaactctaactgtcagggaagaccaagtcttc
cctatgaaccctccgaaatatgacaaaattgaggacatggccatgatgactcatctacac
gagcctggagtgctgtacaacctcaaagagcgctatgcagcctggatgatctacacctac
tcaggcctcttctgtgtcaccgtcaacccctacaagtggctgccggtgtacaagcccgag
gtggtggctgcctacagaggcaaaaagcgccaggaggccccgccccacatcttctccatc
tctgacaatgcctatcagttcatgttgactgatcgagagaatcagtccatcctgatcacc
ggagaatctggtgccggaaagactgtgaacaccaagcgtgtcatccaatactttgcaaca
attgcagttactggagagaagaagaaggatgaatctggcaaaatgcaggggactctggaa
gatcaaatcatcagcgccaatcccctactggaggcctttggcaatgccaaaactgtgagg
aatgacaactcctctcgctttggtaaattcattagaatccactttggtactacagggaag
ctggcatctgctgatatagaaacatatcttttagaaaagtccagagttactttccagcta
aaggcggaaagaagctaccatattttttatcagatcacttccaataagaagccagatcta
attgaaatgctcctgatcaccaccaacccatatgactatgccttcgtcagtcagggggag
atcacagttcccagtattgatgaccaagaagagttgatggccactgatagtgccattgac
atcctgggcttcactcctgaagagaaagtgtccatctataaactcacaggggctgtgatg
cattatgggaacatgaaattcaagcaaaagcagcgtgaggagcaagctgagccagatggc
acagaagtcgctgacaaggcagcctatctccagagtctgaactctgcagacctactcaaa
gccctctgctaccctagggtcaaggttggcaatgagtatgtcaccaaaggccagactgtg
cagcaggtgtacaatgcggtgggtgctctggccaaagccgtctacgagaagatgttcctg
tggatggtcacccgcatcaaccagcagctggacaccaagcagcccaggcagtacttcatc
ggggtcttggacattgctggctttgaaatctttgattttaacagcctggagcagctgtgc
atcaacttcaccaacgagaaactgcaacagtttttcaaccaccacatgtttgtgctagag
caggaggagtacaagaaggaaggcatcgagtggacgttcattgactttgggatggacctg
gctgcctgcattgagctcattgagaagccactgggcatcttctccatcctggaagaggag
tgcatgttccctaaggcaacggacacctccttcaagaacaagctgtatgaccagcacctg
ggcaagtctgccaacttccagaagcccaaggtggtcaaaggcaaggctgaggcccacttc
tctctgattcactatgctggcactgtggactacaacattactggctggctggacaaaaat
aaggaccccctgaatgatactgtggttgggctgtaccagaagtctgcaatgaagactcta
gccagtctcttttccacgtatgctagtgctgaagcagatagcagcgcgaagaaaggtgct
aagaaaaagggctcttctttccagactgtgtctgcccttttcagggaaaatttaaataaa
ttgatgacgaatctgaggagcacacaccctcacttcgtacggtgtatcattcccaatgaa
accaaaactcctggggcaatggaacatgaacttgtgttgcaccagctgaggtgtaatggt
gtgctggaaggcatccgcatctgtaggaaaggattcccaagcagaatcttatatggtgat
ttcaaacaaagatacaaggttttaaatgcaagtgctattccagagggacagttcattgac
agcaagaaggcttctgagaaacttcttgcatctattgatattgatcatactcaatataaa
tttggacataccaaggttttcttcaaagctggacttctgggtcttctggaagaaatgaga
gatgaaaaattagcccaaattataacaagaacacaagctgtctgtaggggattcctaatg
agggtagaatatcagaagatgttgcaaaggagagaagcacttttctgcatccagtataat
gtccgtgccttcatgaacgtcaagcactggccctggatgaaactctttttcaagattaag
cccctcctcaagagtgcagagaccgagaaagagatggccaccatgaaggaagaattccag
aaaaccaaagatgaactcgccaagtcagaggcaaaacggaaggagctagaggaaaaaatg
gtcactctcttaaaagagaaaaatgacctgcaactccaggttcaatctgaagcagatagc
ttggctgatgcagaggaaaggtgtgagcaactgattaaaaacaaaatccaacttgaggcc
aaaatcaaagaggtgactgaaagagctgaggaggaggaagagatcaatgctgagctgaca
gccaagaagagaaaactggaggatgaatgttcagaactcaagaaagacattgatgacctt
gagctgacactggccaaggttgagaaggagaaacatgccacggagaacaaggtgaaaaat
cttacagaagagatggcaggcctggatgaaaccattgcaaaactgtccaaggagaagaag
gctctccaagagacccaccagcagaccctggatgacctgcaggcagaggaggacaaagtc
aacatcctgaccaaagctaaaaccaagctagaacagcaagtggatgatcttgaagggtct
ctggaacaagaaaagaagcttcgaatggatctagaaagagcaaagcggaaactggagggt
gacctcaaattggcccaagaatccacaatggatatggaaaatgacaaacagcaacttgat
gaaaagcttgaaaagaaagaatttgaaatcagcaatttgataagcaaaattgaagatgag
caagctgtagaaattcaactacagaagaagatcaaagagttgcaggcccgcattgaggag
ctgggggaagaaatcgaggcagagagggcgtcccgagccaaagcggagaagcagcgctct
gacctctcccgggaactggaggagatcagcgagaggctggaagaagccggtggggcaact
tctgctcaggtggaattgaacaagaagcgggaggctgagtttcagaaactgcgcagggac
ctggaggaggccaccctgcagcatgaagctatggtggctgctcttcggaagaagcacgca
gacagtatggctgagcttggggagcagattgacaacttgcagcgggtcaaacagaagctg
gagaaggagaagagtgagctgaagatggagactgatgacctcagcagtaacgcagaggcc
atttccaaagccaagggaaaccttgaaaagatgtgccgctctctagaagatcaagtgagt
gagcttaagaccaaggaagaggagcagcagcggctgatcaatgacctcacagcacagaga
gcgcgcctgcagacagaagcgggtgaatattctcgacaattagatgagaaagatgcttta
gtctctcagctttcaaggagcaagcaagcatctactcagcagattgaagagctgaaacat
caactagaggaagaaactaaagccaagaacgccctggcacacgccctgcagtcctcccgc
catgactgcgacctgctgcgggaacagtatgaggaagagcaggaaggcaaagctgagctg
cagagggcgctgtccaaggccaacagtgaggttgcccagtggagaaccaaatacgagacg
gatgccatccagcgcacagaggagctggaggaggccaagaaaaagttggcccagcgcctg
caagaagctgaggaacatgtagaagctgtgaacgccaaatgtgcttcccttgagaagacg
aagcagcggctccagaatgaagttgaagacctcatgcttgatgtggaaaggtctaatgca
gcctgtgcagcccttgataagaagcaaaggaactttgacaaggtcctatcagaatggaag
cagaagtatgaggaaactcaggctgaacttgaggcctcccagaaggagtcacgttctctt
agcactgagctgttcaaggtgaagaatgtctatgaggaatccctggatcaactcgaaacg
ctaagaagagaaaataagaacttgcaacaggagatttctgacctcactgagcagattgca
gagggaggaaagcaaattcatgaattggagaaaataaagaagcaagtagaacaagagaaa
tgtgaaattcaggctgctttagaggaagcagaggcatctcttgaacatgaagaaggaaag
attctgcgtatccagcttgagttaaaccaagtcaagtctgaagttgatagaaaaatcgca
gaaaaggatgaggaaattgaccagctgaagagaaaccacactagagtcgtggagacaatg
cagagcacgctggatgcagagattagaagcagaaatgatgctctgagagtcaagaagaaa
atggaaggagatctgaatgaaatggaaatccagctgaaccatgccaatcgcttagctgca
gagagtttaaggaactacaggaacacccaaggaatcctgaaggaaacccagctccacctg
gatgatgctctccggggccaggaggacctcaaggaacagctggcaattgtggagcgcaga
gccaacctgctgcaggctgagatcgaggagctgtgggccactctggaacagacagagaga
agcaggaaaatcgccgaacaggagctcctggatgccagtgagcgtgtccagctcctccac
acccagaataccagtctcattaacaccaagaagaaattagaaaatgacgtttcccaactc
caaagtgaagtggaagaagtaatccaagaatcacgcaatgcagaagagaaagccaagaag
gccatcactgatgctgccatgatggctgaggagctgaagaaggaacaggacaccagcgcc
cacctggagcggatgaagaagaacctggagcagacggtgaaggacctgcagcatcgtcta
gatgaggccgagcagctggcgctgaagggtgggaagaagcagatccagaaactggaggcc
agggtacgtgagcttgaaggagaggttgaaaatgaacagaaacgtaatgcagaggctgtt
aaaggtttacggaaacatgagcgacgagtaaaagaactcacctaccagactgaagaagat
cgcaagaatgttctcaggctgcaggacttggtagataaattacaggcgaaggtgaaatca
tacaagagacaagctgaggaggctgaggaacaatccaatgctaatctatctaaattccgc
aaactccagcatgagctggaggaggccgaggaacgggctgacattgctgagtcccaggtc
aacaaattgcgagtgaagagccgagaggttcacacaaaaatcagtgcagagtaa

DBGET integrated database retrieval system