KEGG   Homo sapiens (human): 4634Help
Entry
4634              CDS       T01001                                 

Gene name
MYL3, CMH8, MLC1SB, MLC1V, VLC1
Definition
myosin, light chain 3, alkali; ventricular, skeletal, slow
Orthology
K12749  
myosin light chain 3
Organism
hsa  Homo sapiens (human)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Disease
H00292  
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    4634 (MYL3)
   04261 Adrenergic signaling in cardiomyocytes
    4634 (MYL3)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    4634 (MYL3)
   05414 Dilated cardiomyopathy (DCM)
    4634 (MYL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.3-p21.2
AA seq 195 aa AA seqDB search
MAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFML
FDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFETFLPMLQH
ISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDSN
GCINYEAFVKHIMSS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcccccaaaaagccagagcccaagaaggatgatgccaaggcagcccccaaggcagct
ccagctcccgcacctccccctgagcctgagcgccctaaggaggtcgagtttgatgcttcc
aagatcaagattgagttcacacctgagcagattgaagagttcaaggaagccttcatgctg
ttcgaccgcacacccaagtgtgagatgaagatcacctacgggcagtgtggggatgtcctg
cgggcgctgggccagaaccccacacaggcagaagtgctccgtgtcctggggaagccaaga
caggaagagctcaataccaagatgatggactttgaaactttcctgcctatgctccagcac
atttccaagaacaaggacacaggcacctatgaggacttcgtggaggggctgcgggtcttc
gacaaggagggcaatggcactgtcatgggtgctgagcttcgccacgtgctggccacgctg
ggtgagaggctgacagaagacgaagtggagaagttgatggctgggcaagaggactccaat
ggctgcatcaactatgaagcatttgtgaagcacatcatgtccagctaa

DBGET integrated database retrieval system