KEGG   Homo sapiens (human): 4634Help
Entry
4634              CDS       T01001                                 

Gene name
MYL3, CMH8, MLC1SB, MLC1V, VLC1
Definition
myosin, light chain 3, alkali; ventricular, skeletal, slow
Orthology
K12749  
myosin light chain 3
Organism
hsa  Homo sapiens (human)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Disease
H00292  
Hypertrophic cardiomyopathy (HCM)
Class
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:hsa04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:hsa05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.3-p21.2
AA seq 195 aa AA seqDB search
MAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFML
FDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFETFLPMLQH
ISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDSN
GCINYEAFVKHIMSS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcccccaaaaagccagagcccaagaaggatgatgccaaggcagcccccaaggcagct
ccagctcccgcacctccccctgagcctgagcgccctaaggaggtcgagtttgatgcttcc
aagatcaagattgagttcacacctgagcagattgaagagttcaaggaagccttcatgctg
ttcgaccgcacacccaagtgtgagatgaagatcacctacgggcagtgtggggatgtcctg
cgggcgctgggccagaaccccacacaggcagaagtgctccgtgtcctggggaagccaaga
caggaagagctcaataccaagatgatggactttgaaactttcctgcctatgctccagcac
atttccaagaacaaggacacaggcacctatgaggacttcgtggaggggctgcgggtcttc
gacaaggagggcaatggcactgtcatgggtgctgagcttcgccacgtgctggccacgctg
ggtgagaggctgacagaagacgaagtggagaagttgatggctgggcaagaggactccaat
ggctgcatcaactatgaagcatttgtgaagcacatcatgtccagctaa

DBGET integrated database retrieval system