KEGG   Homo sapiens (human): 4636Help
Entry
4636              CDS       T01001                                 

Gene name
MYL5
Definition
myosin, light chain 5, regulatory
Orthology
K12753  
myosin regulatory light chain 5
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    4636 (MYL5)
  Cell communication
   04510 Focal adhesion
    4636 (MYL5)
   04530 Tight junction
    4636 (MYL5)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    4636 (MYL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p16.3
AA seq 173 aa AA seqDB search
MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA
SLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKI
NKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaggaagaccaagaagaaggaagggggtgccctccgggcccagagagcctca
tccaatgtcttctccaactttgagcagactcagatccaggagttcaaggaggcattcaca
ctcatggatcagaaccgagatggcttcattgacaaggaggacctgaaggacacctatgcc
tccctgggcaagaccaacgtcaaggacgacgagctggacgccatgctcaaagaggcctcg
gggcccatcaacttcaccatgtttctgaacctgtttggggagaagctgagcggtaccgac
gccgaggagaccattcttaacgccttcaagatgctggacccggacgggaaagggaaaatc
aacaaggagtacatcaagcgtctgctgatgtcccaggctgacaagatgacggcggaagag
gtggaccagatgttccagttcgcctccatcgatgtggcgggcaacctggactacaaggcg
ctcagctacgtgatcacccacggggaggagaaggaggagtga

DBGET integrated database retrieval system