KEGG   Homo sapiens (human): 4636Help
Entry
4636              CDS       T01001                                 

Gene name
MYL5
Definition
myosin, light chain 5, regulatory
Orthology
K12753  
myosin regulatory light chain 5
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p16.3
AA seq 173 aa AA seqDB search
MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA
SLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKI
NKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaggaagaccaagaagaaggaagggggtgccctccgggcccagagagcctca
tccaatgtcttctccaactttgagcagactcagatccaggagttcaaggaggcattcaca
ctcatggatcagaaccgagatggcttcattgacaaggaggacctgaaggacacctatgcc
tccctgggcaagaccaacgtcaaggacgacgagctggacgccatgctcaaagaggcctcg
gggcccatcaacttcaccatgtttctgaacctgtttggggagaagctgagcggtaccgac
gccgaggagaccattcttaacgccttcaagatgctggacccggacgggaaagggaaaatc
aacaaggagtacatcaagcgtctgctgatgtcccaggctgacaagatgacggcggaagag
gtggaccagatgttccagttcgcctccatcgatgtggcgggcaacctggactacaaggcg
ctcagctacgtgatcacccacggggaggagaaggaggagtga

DBGET integrated database retrieval system