KEGG   Homo sapiens (human): 4637Help
Entry
4637              CDS       T01001                                 

Gene name
MYL6, ESMLC, LC17, LC17-GI, LC17-NM, LC17A, LC17B, MLC-3, MLC1SM, MLC3NM, MLC3SM
Definition
myosin, light chain 6, alkali, smooth muscle and non-muscle
Orthology
K12751  
myosin light chain 6
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Oxytocin signaling pathway
Class
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.2
AA seq 151 aa AA seqDB search
MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM
NVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKM
TEEEVEMLVAGHEDSNGCINYEAFVRHILSG
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgacttcaccgaagaccagaccgcagagttcaaggaggccttccagctgtttgac
cgaacaggtgatggcaagatcctgtacagccagtgtggggatgtgatgagggccctgggc
cagaaccctaccaacgccgaggtgctcaaggtcctggggaaccccaagagtgatgagatg
aatgtgaaggtgctggactttgagcactttctgcccatgctgcagacagtggccaagaac
aaggaccagggcacctatgaggattatgtcgaaggacttcgggtgtttgacaaggaagga
aatggcaccgtcatgggtgctgaaatccggcatgttcttgtcacactgggtgagaagatg
acagaggaagaagtagagatgctggtggcagggcatgaggacagcaatggttgtatcaac
tatgaagcgtttgtgaggcatatcctgtcggggtga

DBGET integrated database retrieval system