KEGG   Homo sapiens (human): 4638Help
Entry
4638              CDS       T01001                                 

Gene name
MYLK, AAT7, KRP, MLCK, MLCK1, MLCK108, MLCK210, MSTP083, MYLK1, smMLCK
Definition
myosin light chain kinase (EC:2.7.11.18)
Orthology
K00907  
myosin-light-chain kinase [EC:2.7.11.18]
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Focal adhesion
Platelet activation
Regulation of actin cytoskeleton
Oxytocin signaling pathway
Gastric acid secretion
Disease
H00801  
Familial thoracic aortic aneurysm and dissection (TAAD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    4638 (MYLK)
   04022 cGMP - PKG signaling pathway
    4638 (MYLK)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    4638 (MYLK)
  Cellular commiunity
   04510 Focal adhesion
    4638 (MYLK)
 Organismal Systems
  Immune system
   04611 Platelet activation
    4638 (MYLK)
  Endocrine system
   04921 Oxytocin signaling pathway
    4638 (MYLK)
  Circulatory system
   04270 Vascular smooth muscle contraction
    4638 (MYLK)
  Digestive system
   04971 Gastric acid secretion
    4638 (MYLK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     4638 (MYLK)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  MLCK family
   4638 (MYLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q21
AA seq 1914 aa AA seqDB search
MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP
EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE
LTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF
SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSG
KASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSP
QRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG
LGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKP
QSQEVKENQTVKFRCEVSGIPKPEVAWFLEGTPVRRQEGSIEVYEDAGSHYLCLLKARTR
DSGTYSCTASNAQGQLSCSWTLQVERLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT
PVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTV
HEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNG
NEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQ
PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLV
LKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADG
GGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL
LGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKK
GTSKTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPS
GPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRG
HAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKT
TKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPE
MKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK
VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQ
AQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE
LATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD
DEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSA
KEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTER
ECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKV
LFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDF
DDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM
ARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAV
AEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYD
EDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE
NT seq 5745 nt NT seq  +upstreamnt  +downstreamnt
atgggggatgtgaagctggttgcctcgtcacacatttccaaaacctccctcagtgtggat
ccctcaagagttgactccatgcccctgacagaggcccctgctttcattttgccccctcgg
aacctctgcatcaaagaaggagccaccgccaagttcgaagggcgggtccggggttaccca
gagccccaggtgacatggcacagaaacgggcaacccatcaccagcgggggccgcttcctg
ctggattgcggcatccgggggactttcagccttgtgattcatgctgtccatgaggaggac
aggggaaagtatacctgtgaagccaccaatggcagtggtgctcgccaggtgacagtggag
ttgacagtagaaggaagttttgcgaagcagcttggtcagcctgttgtttccaaaacctta
ggggatagattttcagctccagcagtggagacccgtcctagcatctggggggagtgccca
ccaaagtttgctaccaagctgggccgagttgtggtcaaagaaggacagatgggacgattc
tcctgcaagatcactggccggccccaaccgcaggtcacctggctcaagggaaatgttcca
ctgcagccgagtgcccgtgtgtctgtgtctgagaagaacggcatgcaggttctggaaatc
catggagtcaaccaagatgacgtgggagtgtacacgtgcctggtggtgaacgggtcgggg
aaggcctcgatgtcagctgaactttccatccaaggtttggacagtgccaataggtcattt
gtgagagaaacaaaagccaccaattcagatgtcaggaaagaggtgaccaatgtaatctca
aaggagtcgaagctggacagtctggaggctgcagccaaaagcaagaactgctccagcccc
cagagaggtggctccccaccctgggctgcaaacagccagcctcagcccccaagggagtcc
aagctggagtcatgcaaggactcgcccagaacggccccgcagaccccggtccttcagaag
acttccagctccatcaccctgcaggccgcaagagttcagccggaaccaagagcaccaggc
ctgggggtcctatcaccttctggagaagagaggaagaggccagctcctccccgtccagcc
accttccccaccaggcagcctggcctggggagccaagatgttgtgagcaaggctgctaac
aggagaatccccatggagggccagagggattcagcattccccaaatttgagagcaagccc
caaagccaggaggtcaaggaaaatcaaactgtcaagttcagatgtgaagtttccgggatt
ccaaagcctgaagtggcctggttcctggaaggcacccccgtgaggagacaggaaggcagc
attgaggtttatgaagatgctggctcccattacctctgcctgctgaaagcccggaccagg
gacagtgggacatacagctgcactgcttccaacgcccaaggccagctgtcctgtagctgg
accctccaagtggaaaggcttgccgtgatggaggtggccccctccttctccagtgtcctg
aaggactgcgctgttattgagggccaggattttgtgctgcagtgctccgtacgggggacc
ccagtgccccggatcacttggctgctgaatgggcagcccatccagtacgctcgctccacc
tgcgaggccggcgtggctgagctccacatccaggatgccctgccggaggaccatggcacc
tacacctgcctagctgagaatgccttggggcaggtgtcctgcagcgcctgggtcaccgtc
catgaaaagaagagtagcaggaagagtgagtaccttctgcctgtggctcccagcaagccc
actgcacccatcttcctgcagggcctctctgatctcaaagtcatggatggaagccaggtc
actatgactgtccaagtgtcagggaatccaccccctgaagtcatctggctgcacaatggg
aatgagatccaagagtcagaggacttccactttgaacagagaggaactcagcacagcctt
tgtatccaggaagtgttcccggaggacacgggcacgtacacctgcgaggcctggaacagc
gctggagaggtccgcacccaggccgtgctcacggtacaagagcctcacgatggcacccag
ccctggttcatcagtaagcctcgctcagtgacagcctccctgggccagagtgtcctcatc
tcctgcgccatagctggtgacccctttcctaccgtgcactggctcagagatggcaaagcc
ctctgcaaagacactggccacttcgaggtgcttcagaatgaggacgtgttcaccctggtt
ctaaagaaggtgcagccctggcatgccggccagtatgagatcctgctcaagaaccgggtt
ggcgaatgcagttgccaggtgtcactgatgctacagaacagctctgccagagcccttcca
cgggggagggagcctgccagctgcgaggacctctgtggtggaggagttggtgctgatggt
ggtggtagtgaccgctatgggtccctgaggcctggctggccagcaagagggcagggttgg
ctagaggaggaagacggcgaggacgtgcgaggggtgctgaagaggcgcgtggagacgagg
cagcacactgaggaggcgatccgccagcaggaggtggagcagctggacttccgagacctc
ctggggaagaaggtgagtacaaagaccctatcggaagacgacctgaaggagatcccagcc
gagcagatggatttccgtgccaacctgcagcggcaagtgaagccaaagactgtgtctgag
gaagagaggaaggtgcacagcccccagcaggtcgattttcgctctgtcctggccaagaag
gggacttccaagacccccgtgcctgagaaggtgccaccgccaaaacctgccaccccggat
tttcgctcagtgctgggtggcaagaagaaattaccagcagagaatggcagcagcagtgcc
gagaccctgaatgccaaggcagtggagagttccaagcccctgagcaatgcacagccttca
gggcccttgaaacccgtgggcaacgccaagcctgctgagaccctgaagccaatgggcaac
gccaagcctgccgagaccctgaagcccatgggcaatgccaagcctgatgagaacctgaaa
tccgctagcaaagaagaactcaagaaagacgttaagaatgatgtgaactgcaagagaggc
catgcagggaccacagataatgaaaagagatcagagagccaggggacagccccagccttc
aagcagaagctgcaagatgttcatgtggcagagggcaagaagctgctgctccagtgccag
gtgtcttctgaccccccagccaccatcatctggacgctgaacggaaagaccctcaagacc
accaagttcatcatcctctcccaggaaggctcactctgctccgtctccatcgagaaggca
ctgcctgaggacagaggcttatacaagtgtgtagccaagaatgacgctggccaggcggag
tgctcctgccaagtcaccgtggatgatgctccagccagtgagaacaccaaggccccagag
atgaaatcccggaggcccaagagctctcttcctcccgtgctaggaactgagagtgatgcg
actgtgaaaaagaaacctgcccccaagacacctccgaaggcagcaatgccccctcagatc
atccagttccctgaggaccagaaggtacgcgcaggagagtcagtggagctgtttggcaaa
gtgacaggcactcagcccatcacctgtacctggatgaagttccgaaagcagatccaggaa
agcgagcacatgaaggtggagaacagcgagaatggcagcaagctcaccatcctggccgcg
cgccaggagcactgcggctgctacacactgctggtggagaacaagctgggcagcaggcag
gcccaggtcaacctcactgtcgtggataagccagaccccccagctggcacaccttgtgcc
tctgacattcggagctcctcactgaccctgtcctggtatggctcctcatatgatgggggc
agtgctgtacagtcctacagcatcgagatctgggactcagccaacaagacgtggaaggaa
ctagccacatgccgcagcacctctttcaacgtccaggacctgctgcctgaccacgaatat
aagttccgtgtacgtgcaatcaacgtgtatggaaccagtgagccaagccaggagtctgaa
ctcacaacggtaggagagaaacctgaagagccgaaggatgaagtggaggtgtcagatgat
gatgagaaggagcccgaggttgattaccggacagtgacaatcaatactgaacaaaaagta
tctgacttctacgacattgaggagagattaggatctgggaaatttggacaggtctttcga
cttgtagaaaagaaaactcgaaaagtctgggcagggaagttcttcaaggcatattcagca
aaagagaaagagaatatccggcaggagattagcatcatgaactgcctccaccaccctaag
ctggtccagtgtgtggatgcctttgaagaaaaggccaacatcgtcatggtcctggagatc
gtgtcaggaggggagctgtttgagcgcatcattgacgaggactttgagctgacggagcgt
gagtgcatcaagtacatgcggcagatctcggagggagtggagtacatccacaagcagggc
atcgtgcacctggacctcaagccggagaacatcatgtgtgtcaacaagacgggcaccagg
atcaagctcatcgactttggtctggccaggaggctggagaatgcggggtctctgaaggtc
ctctttggcaccccagaatttgtggctcctgaagtgatcaactatgagcccatcggctac
gccacagacatgtggagcatcggggtcatctgctacatcctagtcagtggcctttccccc
ttcatgggagacaacgataacgaaaccttggccaacgttacctcagccacctgggacttc
gacgacgaggcattcgatgagatctccgacgatgccaaggatttcatcagcaatctgctg
aagaaagatatgaaaaaccgcctggactgcacgcagtgccttcagcatccatggctaatg
aaagataccaagaacatggaggccaagaaactctccaaggaccggatgaagaagtacatg
gcaagaaggaaatggcagaaaacgggcaatgctgtgagagccattggaagactgtcctct
atggcaatgatctcagggctcagtggcaggaaatcctcaacagggtcaccaaccagcccg
ctcaatgcagaaaaactagaatctgaagaagatgtgtcccaagctttccttgaggctgtt
gctgaggaaaagcctcatgtaaaaccctatttctctaagaccattcgcgatttagaagtt
gtggagggaagtgctgctagatttgactgcaagattgaaggatacccagaccccgaggtt
gtctggttcaaagatgaccagtcaatcagggagtcccgccacttccagatagactacgat
gaggacgggaactgctctttaattattagtgatgtttgcggggatgacgatgccaagtac
acctgcaaggctgtcaacagtcttggagaagccacctgcacagcagagctcattgtggaa
acgatggaggaaggtgaaggggaaggggaagaggaagaagagtga

DBGET integrated database retrieval system