KEGG   Homo sapiens (human): 4641Help
Entry
4641              CDS       T01001                                 

Gene name
MYO1C, MMI-beta, MMIb, NMI, myr2
Definition
(RefSeq) myosin IC
  KO
K10356  
myosin I
Organism
hsa  Homo sapiens (human)
Brite
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4641 (MYO1C)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   B-WICH complex
    4641 (MYO1C)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4641 (MYO1C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4641 (MYO1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13.3
AA seq 1063 aa AA seqDB search
MALQVELVPTGEIIRVVHPHRPCKLALGSDGVRVTMESALTARDRVGVQDFVLLENFTSE
AAFIENLRRRFRENLIYTYIGPVLVSVNPYRDLQIYSRQHMERYRGVSFYEVPPHLFAVA
DTVYRALRTERRDQAVMISGESGAGKTEATKRLLQFYAETCPAPERGGAVRDRLLQSNPV
LEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRVVHQNHGERNFHIF
YQLLEGGEEETLRRLGLERNPQSYLYLVKGQCAKVSSINDKSDWKVVRKALTVIDFTEDE
VEDLLSIVASVLHLGNIHFAANEESNAQVTTENQLKYLTRLLSVEGSTLREALTHRKIIA
KGEELLSPLNLEQAAYARDALAKAVYSRTFTWLVGKINRSLASKDVESPSWRSTTVLGLL
DIYGFEVFQHNSFEQFCINYCNEKLQQLFIELTLKSEQEEYEAEGIAWEPVQYFNNKIIC
DLVEEKFKGIISILDEECLRPGEATDLTFLEKLEDTVKHHPHFLTHKLADQRTRKSLGRG
EFRLLHYAGEVTYSVTGFLDKNNDLLFRNLKETMCSSKNPIMSQCFDRSELSDKKRPETV
ATQFKMSLLQLVEILQSKEPAYVRCIKPNDAKQPGRFDEVLIRHQVKYLGLLENLRVRRA
GFAYRRKYEAFLQRYKSLCPETWPTWAGRPQDGVAVLVRHLGYKPEEYKMGRTKIFIRFP
KTLFATEDALEVRRQSLATKIQAAWRGFHWRQKFLRVKRSAICIQSWWRGTLGRRKAAKR
KWAAQTIRRLIRGFVLRHAPRCPENAFFLDHVRTSFLLNLRRQLPQNVLDTSWPTPPPAL
REASELLRELCIKNMVWKYCRSISPEWKQQLQQKAVASEIFKGKKDNYPQSVPRLFISTR
LGTDEISPRVLQALGSEPIQYAVPVVKYDRKGYKPRSRQLLLTPNAVVIVEDAKVKQRID
YANLTGISVSSLSDSLFVLHVQRADNKQKGDVVLQSDHVIETLTKTALSANRVNSININQ
GSITFAGGPGRDGTIDFTPGSELLITKAKNGHLAVVAPRLNSR
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcaagtggagctggtacccaccggggagatcatccgcgtggttcatccccac
aggccctgcaagcttgccctgggcagtgacggggttcgggtgaccatggagagtgcgctc
accgcccgtgaccgggtgggggtgcaggatttcgtgctgctggagaacttcaccagcgag
gccgccttcatcgagaacctgcggcggcgatttcgggagaatctcatctacacctacatt
ggccccgtcctggtctctgtcaatccctaccgggacctgcagatctacagccggcagcat
atggagcgttaccgtggcgtcagcttctatgaagtgccccctcacctgtttgccgtggcg
gacactgtgtaccgagcactgcgcacggagcgtcgggaccaggctgtgatgatctctggg
gagagcggggcaggcaagaccgaggccaccaagaggctgctgcagttctatgcagagacc
tgcccagcccccgagcgcggaggtgccgtgcgggaccggctgctacagagcaacccggtg
ctggaggcctttggaaatgccaagaccctccggaacgataactccagcaggttcgggaag
tacatggatgtgcagtttgacttcaagggtgcccccgtgggtggccacatcctcagttac
ctcctggaaaagtcacgagtggtgcaccagaatcatggggagcggaacttccacatcttc
taccagctgctggaggggggcgaggaggagactcttcgcaggctgggcttggaacggaac
ccccagagctacctgtacctggtgaagggccagtgtgccaaagtctcctccatcaacgac
aagagtgactggaaggtcgtcaggaaggctctgacagtcattgatttcaccgaggatgaa
gtggaggacctgctgagcatcgtggccagcgtccttcatttgggcaacatccactttgct
gccaacgaggagagcaatgcccaggtcaccaccgagaaccagctcaagtatctgaccagg
ctcctcagcgtggaaggctcgacgctgcgagaagccctgacacacaggaagatcatcgcc
aagggggaggagctcctgagcccgctgaacctggagcaggccgcgtacgcacgagacgcc
ctcgccaaggctgtgtacagccgcacttttacctggctcgtcgggaagatcaacaggtcg
ctggcctccaaggacgtggagagccccagctggcggagcaccacggttctcgggctcctg
gatatttatggctttgaagtgtttcagcataacagctttgagcagttctgcatcaattac
tgcaacgagaagctgcagcagctcttcatcgagctcacgctcaagtcggagcaggaggag
tacgaggcagagggcatcgcgtgggagcccgtccagtatttcaacaacaaaatcatctgt
gatctggtggaggagaagtttaagggcatcatctcgattttggatgaggagtgtctgcgc
cccggggaggccacagacctgaccttcctggagaagctggaggatactgtcaagcaccat
ccacacttcctgacgcacaagctggctgaccagcggaccaggaaatctctgggccgaggg
gaattccgccttctgcactatgcgggggaggtgacctacagcgtgaccgggtttctggac
aaaaacaatgaccttctcttccggaaccttaaggagaccatgtgtagctcaaagaatccc
attatgagccagtgctttgaccggagcgagctcagtgacaagaagcggccagagacggtc
gccacccagttcaagatgagcctcctgcagctggtggagatcctgcagtctaaggagccc
gcctacgtccgctgcatcaaacccaatgatgccaaacagcccggccgctttgacgaggtg
ctgatccgccaccaggtgaagtacctggggctgttggaaaacctgcgcgtgcgcagagcc
ggctttgcctatcgccgcaaatacgaagctttcctgcaaaggtacaagtcactgtgccca
gagacgtggcccacgtgggcaggacggccgcaggatggggtggctgtgctggtccgacac
ctgggctacaagccagaagagtacaagatgggcaggaccaagatcttcatccgcttcccc
aagaccctgtttgccacagaggatgccctggaggtccggcggcagagcctggccacaaag
atccaagctgcctggaggggctttcactggcggcagaaattcctccgggtgaagagatca
gccatctgcatccagtcgtggtggcgtggaacactgggccggaggaaggcagccaagagg
aagtgggcggcacagaccatccggcggctcatccgaggcttcgtcctgcgccacgccccc
cgctgccccgagaacgccttcttcctggaccatgtgcgcacctcttttttgctaaacctg
aggcggcagctgccccagaatgtcctggacacctcgtggcccacgcccccacctgccctg
cgtgaggcctcagagcttctgcgggagttgtgcataaagaacatggtgtggaaatactgc
cggagtatcagccctgagtggaagcagcagctgcagcagaaggccgtggctagtgagatc
ttcaagggcaagaaggataattaccctcagagtgtacccaggctcttcatcagcactcgg
cttggtacagatgagatcagcccccgagtgctgcaggccttgggctctgagcccattcag
tatgcggtgcctgttgtgaaatacgaccgcaagggctacaagcctcgctcccggcagctg
ctgctcacgcccaacgccgtcgtcatcgtggaggacgccaaagtcaagcagaggattgat
tacgccaacctgaccggaatctctgtcagcagcctgagcgacagtctttttgtgcttcat
gtacagcgtgcggacaataagcaaaagggagatgtggtgctgcagagtgaccacgtgatt
gagacgctgaccaagacagccctcagtgccaaccgcgtgaacagcatcaacatcaaccag
ggcagcatcacgtttgcagggggccccggcagggatggcaccattgacttcacacccggc
tcggagctgctcatcaccaaggccaagaacgggcacctggctgtggtcgccccacggctg
aattctcggtga

DBGET integrated database retrieval system