KEGG   Homo sapiens (human): 4642Help
Entry
4642              CDS       T01001                                 

Gene name
MYO1D, PPP1R108, myr4
Definition
(RefSeq) myosin ID
  KO
K10356  
myosin I
Organism
hsa  Homo sapiens (human)
Brite
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4642 (MYO1D)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   B-WICH complex
    4642 (MYO1D)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4642 (MYO1D)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4642 (MYO1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q11.2
AA seq 1006 aa AA seqDB search
MAEQESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEVVVSVNPYKLLNIYGR
DTIEQYKGRELYERPPHLFAIADAAYKAMKRRSKDTCIVISGESGAGKTEASKYIMQYIA
AITNPSQRAEVERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFGKYMDINFDFKGDPIGGH
INNYLLEKSRVIVQQPGERSFHSFYQLLQGGSEQMLRSLHLQKSLSSYNYIHVGAQLKSS
INDAAEFRVVADAMKVIGFKPEEIQTVYKILAAILHLGNLKFVVDGDTPLIENGKVVSII
AELLSTKTDMVEKALLYRTVATGRDIIDKQHTEQEASYGRDAFAKAIYERLFCWIVTRIN
DIIEVKNYDTTIHGKNTVIGVLDIYGFEIFDNNSFEQFCINYCNEKLQQLFIQLVLKQEQ
EEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDDACMNVGKVTDEMFLEALNSKLG
KHAHFSSRKLCASDKILEFDRDFRIRHYAGDVVYSVIGFIDKNKDTLFQDFKRLMYNSSN
PVLKNMWPEGKLSITEVTKRPLTAATLFKNSMIALVDNLASKEPYYVRCIKPNDKKSPQI
FDDERCRHQVEYLGLLENVRVRRAGFAFRQTYEKFLHRYKMISEFTWPNHDLPSDKEAVK
KLIERCGFQDDVAYGKTKIFIRTPRTLFTLEELRAQMLIRIVLFLQKVWRGTLARMRYKR
TKAALTIIRYYRRYKVKSYIHEVARRFHGVKTMRDYGKHVKWPSPPKVLRRFEEALQTIF
NRWRASQLIKSIPASDLPQVRAKVAAVEMLKGQRADLGLQRAWEGNYLASKPDTPQTSGT
FVPVANELKRKDKYMNVLFSCHVRKVNRFSKVEDRAIFVTDRHLYKMDPTKQYKVMKTIP
LYNLTGLSVSNGKDQLVVFHTKDNKDLIVCLFSKQPTHESRIGELVGVLVNHFKSEKRHL
QVNVTNPVQCSLHGKKCTVSVETRLNQPQPDFTKNRSGFILSVPGN
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcaggagagcctggaattcggcaaggcagacttcgtgctgatggacaccgtc
tccatgcccgagttcatggccaacctcaggctcagatttgaaaaagggcgcatctatacg
ttcattggagaagtcgtcgtttctgtgaacccttacaagttgttgaacatctatggaaga
gacacaattgagcagtataaaggccgtgagctgtatgagagaccgcctcacctttttgct
attgcggatgctgcttacaaggctatgaagaggcgatcaaaagacacttgtattgtgata
tcaggggaaagtggagctggtaaaacggaagccagtaagtacattatgcagtatattgcg
gccatcaccaaccccagtcagagagcagaggttgaaagagtgaagaatatgttgcttaag
tccaactgtgttttggaagcttttggaaatgccaaaaccaaccgtaatgacaactcaagc
aggtttggaaaatacatggatatcaactttgacttcaagggtgaccctattggtgggcat
atcaataactacttactagaaaagtctcgagtgattgtgcaacagccaggagaaagaagc
tttcattctttctatcagctactccaaggaggttcagaacaaatgctacgctctctacat
ctccagaaatccctttcatcctacaactatattcatgtgggagctcaattaaagtcttct
atcaatgatgctgccgaattcagagttgttgctgatgccatgaaagtcattggcttcaaa
cctgaggagatccaaacagtgtataagattttggctgctattctgcacttgggaaattta
aaatttgtagtagatggtgacacgcctcttattgagaatggcaaagtagtatctatcata
gcagaattgctctctactaagacagatatggttgagaaagcccttctttaccggactgtg
gccacaggccgtgacatcattgacaagcagcacacagaacaagaggccagctacggcaga
gacgcctttgccaaggcaatatatgagcgccttttttgttggatcgttactcgcatcaat
gatattattgaggtcaagaactatgacaccacaatccatgggaaaaacactgttattggt
gtcttggatatctatggctttgaaatctttgacaacaacagttttgaacaattctgtatc
aattactgcaatgagaaactgcagcagctatttattcagctggttctgaagcaagaacaa
gaggaataccagcgggaagggatcccctggaaacatattgactacttcaacaatcagatc
attgttgacctcgtggagcaacagcacaaagggatcattgcaatccttgatgatgcttgc
atgaatgtcggcaaagtcaccgatgaaatgtttcttgaagcacttaacagtaaattgggc
aaacacgcccatttttccagccgaaagctctgtgcctcagacaaaattctggagtttgat
cgagattttcgaattcgacattatgcaggcgatgtagtctattctgtcattggttttatt
gacaaaaataaagatactttatttcaagatttcaagcgccttatgtataacagttcaaat
cctgtgctcaagaatatgtggcctgaaggcaaactgagcattacagaggtgaccaagcga
cctctgactgctgctaccttgtttaagaattctatgattgctctagtagacaaccttgca
tcaaaggaaccatattacgttcgttgcatcaaacccaatgacaagaaatctccacagata
tttgatgatgaacgctgccggcaccaagtagaatatcttggactactggaaaatgtgaga
gtgcgtcgggcaggatttgccttccgccagacatacgagaagtttcttcacaggtataag
atgatctctgaattcacctggcccaaccatgaccttccttcagacaaagaggctgtcaag
aaactaattgaacggtgtggttttcaggatgatgtagcttatgggaagaccaaaattttc
attcgaacaccccgaacattgtttaccttggaagaactccgtgcccagatgctcataagg
attgtcctctttctacaaaaggtgtggcggggcaccctggcccgcatgcggtacaaaaga
accaaggcagctctgacaataatcaggtactaccggcgctacaaagtgaagtcgtacatc
cacgaggtggccagacgcttccatggcgtcaagaccatgcgagactacgggaagcacgtg
aagtggccaagccctcctaaagttcttcgccgttttgaggaggccctgcagacgattttc
aatagatggagagcatcccagctcatcaagagcattccggcctcagacctgccccaggtc
agggcaaaggttgcagccgtggaaatgttgaagggtcaaagggctgacctcgggctccag
agggcctgggagggcaactatcttgcttcaaagccagatacacctcagacctcaggcact
tttgtccctgttgctaatgaattgaaacggaaggacaaatacatgaatgtcctcttttcc
tgtcacgtccgtaaggtaaatcgatttagtaaggtggaagacagagcaatttttgtcact
gaccgtcacctgtataaaatggatcccactaaacagtacaaggtgatgaagactatccct
ctatacaatttgactggtctgagtgtctccaatggaaaggaccaacttgtagtgttccat
acgaaagacaacaaagacctcattgtctgcctcttcagcaaacagccaacccatgagagt
cgaattggagaacttgttggagtgctggtgaatcatttcaagagtgagaagcgccacctt
caagtgaacgtcaccaacccagtacagtgcagcctgcacgggaagaagtgcaccgtctcc
gtggagacgcggctcaaccagccccagcccgacttcaccaagaatcgctcgggcttcatc
ctcagcgtgcccgggaactga

DBGET integrated database retrieval system