KEGG   Homo sapiens (human): 4647Help
Entry
4647              CDS       T01001                                 

Gene name
MYO7A, DFNA11, DFNB2, MYOVIIA, MYU7A, NSRD2, USH1B
Definition
(RefSeq) myosin VIIA
  KO
K10359  
myosin VII
Organism
hsa  Homo sapiens (human)
Disease
H00604  
Deafness, autosomal dominant
H00605  
Deafness, autosomal recessive
H00779  
Usher syndrome (US)
Brite
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4647 (MYO7A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.5
AA seq 2215 aa AA seqDB search
MVILQQGDHVWMDLRLGQEFDVPIGAVVKLCDSGQVQVVDDEDNEHWISPQNATHIKPMH
PTSVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIR
QYTNKKIGEMPPHIFAIADNCYFNMKRNSRDQCCIISGESGAGKTESTKLILQFLAAISG
QHSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKS
RVCRQALDERNYHVFYCMLEGMSEDQKKKLGLGQASDYNYLAMGNCITCEGRVDSQEYAN
IRSAMKVLMFTDTENWEISKLLAAILHLGNLQYEARTFENLDACEVLFSPSLATAASLLE
VNPPDLMSCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVDKINAAIYK
PPSQDVKNSRRSIGLLDIFGFENFAVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLE
SIDWLHIEFTDNQDALDMIANKPMNIISLIDEESKFPKGTDTTMLHKLNSQHKLNANYIP
PKNNHETQFGINHFAGIVYYETQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMG
AETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSG
MMETIRIRRAGYPIRYSFVEFVERYRVLLPGVKPAYKQGDLRGTCQRMAEAVLGTHDDWQ
IGKTKIFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLKLKNAATLIQRHWRG
HNCRKNYGLMRLGFLRLQALHRSRKLHQQYRLARQRIIQFQARCRAYLVRKAFRHRLWAV
LTVQAYARGMIARRLHQRLRAEYLWRLEAEKMRLAEEEKLRKEMSAKKAKEEAERKHQER
LAQLAREDAERELKEKEAARRKKELLEQMERARHEPVNHSDMVDKMFGFLGTSGGLPGQE
GQAPSGFEDLERGRREMVEEDLDAALPLPDEDEEDLSEYKFAKFAATYFQGTTTHSYTRR
PLKQPLLYHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGK
KTYKRELQALQGEGEAQLPEGQKKSSVRHKLVHLTLKKKSKLTEEVTKRLHDGESTVQGN
SMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVG
CFAPSEKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIML
PVTFMDGTTKTLLTDSATTAKELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVM
DAISQCEQYAKEQGAQERNAPWRLFFRKEVFTPWHSPSEDNVATNLIYQQVVRGVKFGEY
RCEKEDDLAELASQQYFVDYGSEMILERLLNLVPTYIPDREITPLKTLEKWAQLAIAAHK
KGIYAQRRTDAQKVKEDVVSYARFKWPLLFSRFYEAYKFSGPSLPKNDVIVAVNWTGVYF
VDEQEQVLLELSFPEIMAVSSSRECRVWLSLGCSDLGCAAPHSGWAGLTPAGPCSPCWSC
RGAKTTAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAGE
ESGFLSFAKGDLIILDHDTGEQVMNSGWANGINERTKQRGDFPTDSVYVMPTVTMPPREI
VALVTMTPDQRQDVVRLLQLRTAEPEVRAKPYTLEEFSYDYFRPPPKHTLSRVMVSKARG
KDRLWSHTREPLKQALLKKLLGSEELSQEACLAFIAVLKYMGDYPSKRTRSVNELTDQIF
EGPLKAEPLKDEAYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQRFLQS
RKHCPLAIDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVES
STKAKDFCQNIATRLLLKSSEGFSLFVKIADKVLSVPENDFFFDFVRHLTDWIKKARPIK
DGIVPSLTYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGAL
IYRVKFEEDKSYFPSIPKLLRELVPQDLIRQVSPDDWKRSIVAYFNKHAGKSKEEAKLAF
LKLIFKWPTFGSAFFEVKQTTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNW
SSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRSGK
NT seq 6648 nt NT seq  +upstreamnt  +downstreamnt
atggtgattcttcagcagggggaccatgtgtggatggacctgagattggggcaggagttc
gacgtgcccatcggggcggtggtgaagctctgcgactctgggcaggtccaggtggtggat
gatgaagacaatgaacactggatctctccgcagaacgcaacgcacatcaagcctatgcac
cccacgtcggtccacggcgtggaggacatgatccgcctgggggacctcaacgaggcgggc
atcttgcgcaacctgcttatccgctaccgggaccacctcatctacacgtatacgggctcc
atcctggtggctgtgaacccctaccagctgctctccatctactcgccagagcacatccgc
cagtataccaacaagaagattggggagatgcccccccacatctttgccattgctgacaac
tgctacttcaacatgaaacgcaacagccgagaccagtgctgcatcatcagtggggaatct
ggggccgggaagacggagagcacaaagctgatcctgcagttcctggcagccatcagtggg
cagcactcgtggattgagcagcaggtcttggaggccacccccattctggaagcatttggg
aatgccaagaccatccgcaatgacaactcaagccgtttcggaaagtacatcgacatccac
ttcaacaagcggggcgccatcgagggcgcgaagattgagcagtacctgctggaaaagtca
cgtgtctgtcgccaggccctggatgaaaggaactaccacgtgttctactgcatgctggag
ggtatgagtgaggatcagaagaagaagctgggcttgggccaggcctctgactacaactac
ttggccatgggtaactgcataacctgtgagggccgggtggacagccaggagtacgccaac
atccgctccgccatgaaggtgctcatgttcactgacaccgagaactgggagatctcgaag
ctcctggctgccatcctgcacctgggcaacctgcagtatgaggcacgcacatttgaaaac
ctggatgcctgtgaggttctcttctccccatcgctggccacagctgcatccctgcttgag
gtgaaccccccagacctgatgagctgcctgactagccgcaccctcatcacccgcggggag
acggtgtccaccccactgagcagggaacaggcactggacgtgcgcgacgccttcgtaaag
gggatctacgggcggctgttcgtgtggattgtggacaagatcaacgcagcaatttacaag
cctccctcccaggatgtgaagaactctcgcaggtccatcggcctcctggacatctttggg
tttgagaactttgctgtgaacagctttgagcagctctgcatcaacttcgccaatgagcac
ctgcagcagttctttgtgcggcacgtgttcaagctggagcaggaggaatatgacctggag
agcattgactggctgcacatcgagttcactgacaaccaggatgccctggacatgattgcc
aacaagcccatgaacatcatctccctcatcgatgaggagagcaagttccccaagggcaca
gacaccaccatgttacacaagctgaactcccagcacaagctcaacgccaactacatcccc
cccaagaacaaccatgagacccagtttggcatcaaccattttgcaggcatcgtctactat
gagacccaaggcttcctggagaagaaccgagacaccctgcatggggacattatccagctg
gtccactcctccaggaacaagttcatcaagcagatcttccaggccgatgtcgccatgggc
gccgagaccaggaagcgctcgcccacacttagcagccagttcaagcggtcactggagctg
ctgatgcgcacgctgggtgcctgccagcccttctttgtgcgatgcatcaagcccaatgag
ttcaagaagcccatgctgttcgaccggcacctgtgcgtgcgccagctgcggtactcagga
atgatggagaccatccgaatccgccgagctggctaccccatccgctacagcttcgtagag
tttgtggagcggtaccgtgtgctgctgccaggtgtgaagccggcctacaagcagggcgac
ctccgcgggacttgccagcgcatggctgaggctgtgctgggcacccacgatgactggcag
ataggcaaaaccaagatctttctgaaggaccaccatgacatgctgctggaagtggagcgg
gacaaagccatcaccgacagagtcatcctccttcagaaagtcatccggggattcaaagac
aggtctaactttctgaagctgaagaacgctgccacactgatccagaggcactggcggggt
cacaactgtaggaagaactacgggctgatgcgtctgggcttcctgcggctgcaggccctg
caccgctcccggaagctgcaccagcagtaccgcctggcccgccagcgcatcatccagttc
caggcccgctgccgcgcctatctggtgcgcaaggccttccgccaccgcctctgggctgtg
ctcaccgtgcaggcctatgcccggggcatgatcgcccgcaggctgcaccaacgcctcagg
gctgagtatctgtggcgcctcgaggctgagaaaatgcggctggcggaggaagagaagctt
cggaaggagatgagcgccaagaaggccaaggaggaggccgagcgcaagcatcaggagcgc
ctggcccagctggctcgtgaggacgctgagcgggagctgaaggagaaggaggccgctcgg
cggaagaaggagctcctggagcagatggaaagggcccgccatgagcctgtcaatcactca
gacatggtggacaagatgtttggcttcctggggacttcaggtggcctgccaggccaggag
ggccaggcacctagtggctttgaggacctggagcgagggcggagggagatggtggaggag
gacctggatgcagccctgcccctgcctgacgaggatgaggaggacctctctgagtataaa
tttgccaagttcgcggccacctacttccaggggacaaccacgcactcctacacccggcgg
ccactcaaacagccactgctctaccatgacgacgagggtgaccagctggcagccctggcg
gtctggatcaccatcctccgcttcatgggggacctccctgagcccaagtaccacacagcc
atgagtgatggcagtgagaagatccctgtgatgaccaagatttatgagaccctgggcaag
aagacgtacaagagggagctgcaggccctgcagggcgagggcgaggcccagctccccgag
ggccagaagaagagcagtgtgaggcacaagctggtgcatttgactctgaaaaagaagtcc
aagctcacagaggaggtgaccaagaggctgcatgacggggagtccacagtgcagggcaac
agcatgctggaggaccggcccacctccaacctggagaagctgcacttcatcatcggcaat
ggcatcctgcggccagcactccgggacgagatctactgccagatcagcaagcagctgacc
cacaacccctccaagagcagctatgcccggggctggattctcgtgtctctctgcgtgggc
tgtttcgccccctccgagaagtttgtcaagtacctgcggaacttcatccacgggggcccg
cccggctacgccccgtactgtgaggagcgcctgagaaggacctttgtcaatgggacacgg
acacagccgcccagctggctggagctgcaggccaccaagtccaagaagccaatcatgttg
cccgtgacattcatggatgggaccaccaagaccctgctgacggactcggcaaccacggcc
aaggagctctgcaacgcgctggccgacaagatctctctcaaggaccggttcgggttctcc
ctctacattgccctgtttgacaaggtgtcctccctgggcagcggcagtgaccacgtcatg
gacgccatctcccagtgcgagcagtacgccaaggagcagggcgcccaggagcgcaacgcc
ccctggaggctcttcttccgcaaagaggtcttcacgccctggcacagcccctccgaggac
aacgtggccaccaacctcatctaccagcaggtggtgcgaggagtcaagtttggggagtac
aggtgtgagaaggaggacgacctggctgagctggcctcccagcagtactttgtagactat
ggctctgagatgatcctggagcgcctcctgaacctcgtgcccacctacatccccgaccgc
gagatcacgcccctgaagacgctggagaagtgggcccagctggccatcgccgcccacaag
aaggggatttatgcccagaggagaactgatgcccagaaggtcaaagaggatgtggtcagt
tatgcccgcttcaagtggcccttgctcttctccaggttttatgaagcctacaaattctca
ggccccagtctccccaagaacgacgtcatcgtggccgtcaactggacgggtgtgtacttt
gtggatgagcaggagcaggtacttctggagctgtccttcccagagatcatggccgtgtcc
agcagcagggagtgccgtgtctggctctcactgggctgctctgatcttggctgtgctgcg
cctcactcaggctgggcaggactgaccccggcggggccctgttctccgtgttggtcctgc
aggggagcgaaaacgacggcccccagcttcacgctggccaccatcaagggggacgaatac
accttcacctccagcaatgctgaggacattcgtgacctggtggtcaccttcctagagggg
ctccggaagagatctaagtatgttgtggccctgcaggataaccccaaccccgcaggcgag
gagtcaggcttcctcagctttgccaagggagacctcatcatcctggaccatgacacgggc
gagcaggtcatgaactcgggctgggccaacggcatcaatgagaggaccaagcagcgtggg
gacttccccaccgacagtgtgtacgtcatgcccactgtcaccatgccaccgcgggagatt
gtggccctggtcaccatgactcccgatcagaggcaggacgttgtccggctcttgcagctg
cgaacggcggagcccgaggtgcgtgccaagccctacacgctggaggagttttcctatgac
tacttcaggcccccacccaagcacacgctgagccgtgtcatggtgtccaaggcccgaggc
aaggaccggctgtggagccacacgcgggaaccgctcaagcaggcgctgctcaagaagctc
ctgggcagtgaggagctctcgcaggaggcctgcctggccttcattgctgtgctcaagtac
atgggcgactacccgtccaagaggacacgctccgtcaacgagctcaccgaccagatcttt
gagggtcccctgaaagccgagcccctgaaggacgaggcatatgtgcagatcctgaagcag
ctgaccgacaaccacatcaggtacagcgaggagcggggttgggagctgctctggctgtgc
acgggccttttcccacccagcaacatcctcctgccccacgtgcagcgcttcctgcagtcc
cgaaagcactgcccactcgccatcgactgcctgcaacggctccagaaagccctgagaaac
gggtcccggaagtaccctccgcacctggtggaggtggaggccatccagcacaagaccacc
cagattttccacaaagtctacttccctgatgacactgacgaggccttcgaagtggagtcc
agcaccaaggccaaggacttctgccagaacatcgccaccaggctgctcctcaagtcctca
gagggattcagcctctttgtcaaaattgcagacaaggtcctcagcgttcctgagaatgac
ttcttctttgactttgttcgacacttgacagactggataaagaaagctcggcccatcaag
gacggaattgtgccctcactcacctaccaggtgttcttcatgaagaagctgtggaccacc
acggtgccagggaaggatcccatggccgattccatcttccactattaccaggagttgccc
aagtatctccgaggctaccacaagtgcacgcgggaggaggtgctgcagctgggggcgctg
atctacagggtcaagttcgaggaggacaagtcctacttccccagcatccccaagctgctg
cgggagctggtgccccaggaccttatccggcaggtctcacctgatgactggaagcggtcc
atcgtcgcctacttcaacaagcacgcagggaagtccaaggaggaggccaagctggccttc
ctgaagctcatcttcaagtggcccacctttggctcagccttcttcgaggtgaagcaaact
acggagccaaacttccctgagatcctcctaattgccatcaacaagtatggggtcagcctc
atcgatcccaaaacgaaggatatcctcaccactcatcccttcaccaagatctccaactgg
agcagcggcaacacctacttccacatcaccattgggaacttggtgcgcgggagcaaactg
ctctgcgagacgtcactgggctacaagatggatgacctcctgacttcctacattagccag
atgctcacagccatgagcaaacagcggggctccaggagcggcaagtga

DBGET integrated database retrieval system