KEGG   Homo sapiens (human): 4651Help
Entry
4651              CDS       T01001                                 

Gene name
MYO10
Definition
myosin X
Orthology
K12559  
myosin X
Organism
hsa  Homo sapiens (human)
Pathway
Fc gamma R-mediated phagocytosis
Class
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:hsa04666]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5p15.1-p14.3
AA seq 2058 aa AA seqDB search
MDNFFTEGTRVWLRENGQHFPSTVNSCAEGIVVFRTDYGQVFTYKQSTITHQKVTAMHPT
NEEGVDDMASLTELHGGSIMYNLFQRYKRNQIYTYIGSILASVNPYQPIAGLYEPATMEQ
YSRRHLGELPPHIFAIANECYRCLWKRHDNQCILISGESGAGKTESTKLILKFLSVISQQ
SLELSLKEKTSCVERAILESSPIMEAFGNAKTVYNNNSSRFGKFVQLNICQKGNIQGGRI
VDYLLEKNRVVRQNPGERNYHIFYALLAGLEHEEREEFYLSTPENYHYLNQSGCVEDKTI
SDQESFREVITAMDVMQFSKEEVREVSRLLAGILHLGNIEFITAGGAQVSFKTALGRSAE
LLGLDPTQLTDALTQRSMFLRGEEILTPLNVQQAVDSRDSLAMALYACCFEWVIKKINSR
IKGNEDFKSIGILDIFGFENFEVNHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLV
WEDIDWIDNGECLDLIEKKLGLLALINEESHFPQATDSTLLEKLHSQHANNHFYVKPRVA
VNNFGVKHYAGEVQYDVRGILEKNRDTFRDDLLNLLRESRFDFIYDLFEHVSSRNNQDTL
KCGSKHRRPTVSSQFKDSLHSLMATLSSSNPFFVRCIKPNMQKMPDQFDQAVVLNQLRYS
GMLETVRIRKAGYAVRRPFQDFYKRYKVLMRNLALPEDVRGKCTSLLQLYDASNSEWQLG
KTKVFLRESLEQKLEKRREEEVSHAAMVIRAHVLGFLARKQYRKVLYCVVIIQKNYRAFL
LRRRFLHLKKAAIVFQKQLRGQIARRVYRQLLAEKREQEEKKKQEEEEKKKREEEERERE
RERREAELRAQQEEETRKQQELEALQKSQKEAELTRELEKQKENKQVEEILRLEKEIEDL
QRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLESLNFDEIDECVRNIERS
LSVGSEFSSELAESACEEKPNFNFSQPYPEEEVDEGFEADDDAFKDSPNPSEHGHSDQRT
SGIRTSDDSSEEDPYMNDTVVPTSPSADSTVLLAPSVQDSGSLHNSSSGESTYCMPQNAG
DLPSPDGDYDYDQDDYEDGAITSGSSVTFSNSYGSQWSPDYRCSVGTYNSSGAYRFSSEG
AQSSFEDSEEDFDSRFDTDDELSYRRDSVYSCVTLPYFHSFLYMKGGLMNSWKRRWCVLK
DETFLWFRSKQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSKLMYFENDSEEKLKGT
VEVRTAKEIIDNTTKENGIDIIMADRTFHLIAESPEDASQWFSVLSQVHASTDQEIQEMH
DEQANPQNAVGTLDVGLIDSVCASDSPDRPNSFVIITANRVLHCNADTPEEMHHWITLLQ
RSKGDTRVEGQEFIVRGWLHKEVKNSPKMSSLKLKKRWFVLTHNSLDYYKSSEKNALKLG
TLVLNSLCSVVPPDEKIFKETGYWNVTVYGRKHCYRLYTKLLNEATRWSSAIQNVTDTKA
PIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDK
GYTTLQDEAIKIFNSLQQLESMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHP
GSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGSEMEKYALFTYESLKKTK
CREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRN
MFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKD
SVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRL
KARISQSTKTFTPCERLEKRRTSFLEGTLRRSFRTGSVVRQKVEEEQMLDMWIKEEVSSA
RASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAV
SVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMI
VKKRYSTTRSASSQGSSR
NT seq 6177 nt NT seq  +upstreamnt  +downstreamnt
atggataacttcttcaccgagggaacacgggtctggctgagagaaaatggccagcatttt
ccaagtactgtaaattcctgtgcagaaggcatcgtcgtcttccggacagactatggtcag
gtattcacttacaagcagagcacaattacccaccagaaggtgactgctatgcaccccacg
aacgaggagggcgtggatgacatggcgtccttgacagagctccatggcggctccatcatg
tataacttattccagcggtataagagaaatcaaatatatacctacatcggctccatcctg
gcctccgtgaacccctaccagcccatcgccgggctgtacgagcctgccaccatggagcag
tacagccggcgccacctgggcgagctgcccccgcacatcttcgccatcgccaacgagtgc
taccgctgcctgtggaagcgccacgacaaccagtgcatcctcatcagtggtgaaagtggg
gcaggtaaaaccgaaagcactaaattgatcctcaagtttctgtcagtcatcagtcaacag
tctttggaattgtccttaaaggagaagacatcctgtgttgaacgagctattcttgaaagc
agccccatcatggaagctttcggcaatgcgaagaccgtgtacaacaacaactctagtcgc
tttgggaagtttgttcagctgaacatctgtcagaaaggaaatattcagggcgggagaatt
gtagattatttattagaaaaaaaccgagtagtaaggcaaaatcccggggaaaggaattat
cacatattttatgcactgctggcagggctggaacatgaagaaagagaagaattttattta
tctacgccagaaaactaccactacttgaatcagtctggatgtgtagaagacaagacaatc
agtgaccaggaatcctttagggaagttattacggcaatggacgtgatgcagttcagcaag
gaggaagttcgggaagtgtcgaggctgcttgctggtatactgcatcttgggaacatagaa
tttatcactgctggtggggcacaggtttccttcaaaacagctttgggcagatctgcggag
ttacttgggctggacccaacacagctcacagatgctttgacccagagatcaatgttcctc
aggggagaagagatcctcacgcctctcaatgttcaacaggcagtagacagcagggactcc
ctggccatggctctgtatgcgtgctgctttgagtgggtaatcaagaagatcaacagcagg
atcaaaggcaatgaggacttcaagtctattggcatcctcgacatctttggatttgaaaac
tttgaggttaatcactttgaacagttcaatataaactatgcaaacgagaaacttcaggag
tacttcaacaagcatattttttctttagaacaactagaatatagccgggaaggattagtg
tgggaagatattgactggatagacaatggagaatgcctggacttgattgagaagaaactt
ggcctcctagcccttatcaatgaagaaagccattttcctcaagccacagacagcacctta
ttggagaagctacacagtcagcatgcgaataaccacttttatgtgaagcccagagttgca
gttaacaattttggagtgaagcactatgctggagaggtgcaatatgatgtccgaggtatc
ttggagaagaacagagatacatttcgagatgaccttctcaatttgctaagagaaagccga
tttgactttatctacgatctttttgaacatgtttcaagccgcaacaaccaggataccttg
aaatgtggaagcaaacatcggcggcctacagtcagctcacagttcaaggactcactgcat
tccttaatggcaacgctaagctcctctaatcctttctttgttcgctgtatcaagccaaac
atgcagaagatgccagaccagtttgaccaggcggttgtgctgaaccagctgcggtactca
gggatgctggagactgtgagaatccgcaaagctgggtatgcggtccgaagaccctttcag
gacttttacaaaaggtataaagtgctgatgaggaatctggctctgcctgaggacgtccga
gggaagtgcacgagcctgctgcagctctatgatgcctccaacagcgagtggcagctgggg
aagaccaaggtctttcttcgagaatccttggaacagaaactggagaagcggagggaagag
gaagtgagccacgcggccatggtgattcgggcccatgtcttgggcttcttagcacgaaaa
caatacagaaaggtcctttattgtgtggtgataatacagaagaattacagagcattcctt
ctgaggaggagatttttgcacctgaaaaaggcagccatagttttccagaagcaactcaga
ggtcagattgctcggagagtttacagacaattgctggcagagaaaagggagcaagaagaa
aagaagaaacaggaagaggaagaaaagaagaaacgggaggaagaagaaagagaaagagag
agagagcgaagagaagccgagctccgcgcccagcaggaagaagaaacgaggaagcagcaa
gaactcgaagccttgcagaagagccagaaggaagctgaactgacccgtgaactggagaaa
cagaaggaaaataagcaggtggaagagatcctccgtctggagaaagaaatcgaggacctg
cagcgcatgaaggagcagcaggagctgtcgctgaccgaggcttccctgcagaagctgcag
gagcggcgggaccaggagctccgcaggctggaggaggaagcgtgcagggcggcccaggag
ttcctcgagtccctcaatttcgacgagatcgacgagtgtgtccggaatatcgagcggtcc
ctgtcggtgggaagcgaattttccagcgagctggctgagagcgcatgcgaggagaagccc
aacttcaacttcagccagccctacccagaggaggaggtcgatgagggcttcgaagccgac
gacgacgccttcaaggactcccccaaccccagcgagcacggccactcagaccagcgaaca
agtggcatccggaccagcgatgactcttcagaggaggacccatacatgaacgacacggtg
gtgcccaccagccccagtgcggacagcacggtgctgctcgccccatcagtgcaggactcc
gggagcctacacaactcctccagcggcgagtccacctactgcatgccccagaacgctggg
gacttgccctccccagacggcgactacgactacgaccaggatgactatgaggacggtgcc
atcacttccggcagcagcgtgaccttctccaactcctacggcagccagtggtcccccgac
taccgctgctctgtggggacctacaacagctcgggtgcctaccggttcagctctgagggg
gcgcagtcctcgtttgaagatagtgaagaggactttgattccaggtttgatacagatgat
gagctttcataccggcgtgactctgtgtacagctgtgtcactctgccgtatttccacagc
tttctgtacatgaaaggtggcctgatgaactcttggaaacgccgctggtgcgtcctcaag
gatgaaaccttcttgtggttccgctccaagcaggaggccctcaagcaaggctggctccac
aaaaaaggggggggctcctccacgctgtccaggagaaattggaagaagcgctggtttgtc
ctccgccagtccaagctgatgtactttgaaaacgacagcgaggagaagctcaagggcacc
gtagaagtgcgaacggcaaaagagatcatagataacaccaccaaggagaatgggatcgac
atcattatggccgataggactttccacctgattgcagagtccccagaagatgccagccag
tggttcagcgtgctgagtcaggtccacgcgtccacggaccaggagatccaggagatgcat
gatgagcaggcaaacccacagaatgctgtgggcaccttggatgtggggctgattgattct
gtgtgtgcctctgacagccctgatagacccaactcgtttgtgatcatcacggccaaccgg
gtgctgcactgcaacgccgacacgccggaggagatgcaccactggataaccctgctgcag
aggtccaaaggggacaccagagtggagggccaggaattcatcgtgagaggatggttgcac
aaagaggtgaagaacagtccaaagatgtcttcactgaaactgaagaaacggtggtttgta
ctcacccacaattccctggattactacaagagttcagagaagaacgcgctcaaactgggg
accctggtcctcaacagcctctgctctgtcgtccccccagatgagaagatattcaaagag
acaggctactggaacgtcaccgtgtacgggcgcaagcactgttaccggctctacaccaag
ctgctcaacgaggccacccggtggtccagtgccattcaaaacgtgactgacaccaaggcc
ccgatcgacacccccacccagcagctgattcaagatatcaaggagaactgcctgaactcg
gatgtggtggaacagatttacaagcggaacccgatccttcgatacacccatcaccccttg
cactccccgctcctgccccttccgtatggggacataaatctcaacttgctcaaagacaaa
ggctataccacccttcaggatgaggccatcaagatattcaattccctgcagcaactggag
tccatgtctgacccaattccaataatccagggcatcctacagacagggcatgacctgcga
cctctgcgggacgagctgtactgccagcttatcaaacagaccaacaaagtgccccacccc
ggcagtgtgggcaacctgtacagctggcagatcctgacatgcctgagctgcaccttcctg
ccgagtcgagggattctcaagtatctcaagttccatctgaaaaggatacgggaacagttt
ccaggaagcgagatggaaaaatacgctctcttcacttacgaatctcttaagaaaaccaaa
tgccgagagtttgtgccttcccgagatgaaatagaagctctgatccacaggcaggaaatg
acatccacggtctattgccatggcggcggctcctgcaagatcaccatcaactcccacacc
accgctggggaggtggtggagaagctgatccgaggcctggccatggaggacagcaggaac
atgtttgctttgtttgaatacaacggccacgtcgacaaagccattgaaagtcgaaccgtc
gtagctgatgtcttagccaagtttgaaaagctggctgccacatccgaggttggggacctg
ccatggaaattctacttcaaactttactgcttcctggacacagacaacgtgccaaaagac
agtgtggagtttgcatttatgtttgaacaggcccacgaagcggttatccatggccaccat
ccagccccggaagaaaacctccaggttcttgctgccctgcgactccagtatctgcagggg
gattatactctgcacgctgccatcccacctctcgaagaggtttattccctgcagagactc
aaggcccgcatcagccagtcaaccaaaaccttcaccccttgtgaacggctggagaagagg
cggacgagcttcctagaggggaccctgaggcggagcttccggacaggatccgtggtccgg
cagaaggtcgaggaggagcagatgctggacatgtggattaaggaagaagtctcctctgct
cgagccagtatcattgacaagtggaggaaatttcagggaatgaaccaggaacaggccatg
gccaagtacatggccttgatcaaggagtggcctggctatggctcgacgctgtttgatgtg
gagtgcaaggaaggtggcttccctcaggaactctggttgggtgtcagcgcggacgccgtc
tccgtctacaagcgtggagagggaagaccactggaagtcttccagtatgaacacatcctc
tcttttggggcacccctggcgaatacgtataagatcgtggtcgatgagagggagctgctc
tttgaaaccagtgaggtggtggatgtggccaagctcatgaaagcctacatcagcatgatc
gtgaagaagcgctacagcacgacacgctccgccagcagccagggcagctccaggtga

DBGET integrated database retrieval system