KEGG   Homo sapiens (human): 4653Help
Entry
4653              CDS       T01001                                 

Gene name
MYOC, GLC1A, GPOA, JOAG, JOAG1, TIGR
Definition
(RefSeq) myocilin
Organism
hsa  Homo sapiens (human)
Disease
H00612  
Primary open angle glaucoma
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q99972(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1q24.3
AA seq 504 aa AA seqDB search
MRFFCARCCSFGPEMPAVQLLLLACLVWDVGARTAQLRKANDQSGRCQYTFSVASPNESS
CPEQSQAMSVIHNLQRDSSTQRLDLEATKARLSSLESLLHQLTLDQAARPQETQEGLQRE
LGTLRRERDQLETQTRELETAYSNLLRDKSVLEEEKKRLRQENENLARRLESSSQEVARL
RRGQCPQTRDTARAVPPGSREVSTWNLDTLAFQELKSELTEVPASRILKESPSGYLRSGE
GDTGCGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFE
YDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEI
PGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETN
IRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYN
PLEKKLFAWDNLNMVTYDIKLSKM
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcttctgtgcacgttgctgcagctttgggcctgagatgccagctgtccagctg
ctgcttctggcctgcctggtgtgggatgtgggggccaggacagctcagctcaggaaggcc
aatgaccagagtggccgatgccagtataccttcagtgtggccagtcccaatgaatccagc
tgcccagagcagagccaggccatgtcagtcatccataacttacagagagacagcagcacc
caacgcttagacctggaggccaccaaagctcgactcagctccctggagagcctcctccac
caattgaccttggaccaggctgccaggccccaggagacccaggaggggctgcagagggag
ctgggcaccctgaggcgggagcgggaccagctggaaacccaaaccagagagttggagact
gcctacagcaacctcctccgagacaagtcagttctggaggaagagaagaagcgactaagg
caagaaaatgagaatctggccaggaggttggaaagcagcagccaggaggtagcaaggctg
agaaggggccagtgtccccagacccgagacactgctcgggctgtgccaccaggctccaga
gaagtttctacgtggaatttggacactttggccttccaggaactgaagtccgagctaact
gaagttcctgcttcccgaattttgaaggagagcccatctggctatctcaggagtggagag
ggagacaccggatgtggagaactagtttgggtaggagagcctctcacgctgagaacagca
gaaacaattactggcaagtatggtgtgtggatgcgagaccccaagcccacctacccctac
acccaggagaccacgtggagaatcgacacagttggcacggatgtccgccaggtttttgag
tatgacctcatcagccagtttatgcagggctacccttctaaggttcacatactgcctagg
ccactggaaagcacgggtgctgtggtgtactcggggagcctctatttccagggcgctgag
tccagaactgtcataagatatgagctgaataccgagacagtgaaggctgagaaggaaatc
cctggagctggctaccacggacagttcccgtattcttggggtggctacacggacattgac
ttggctgtggatgaagcaggcctctgggtcatttacagcaccgatgaggccaaaggtgcc
attgtcctctccaaactgaacccagagaatctggaactcgaacaaacctgggagacaaac
atccgtaagcagtcagtcgccaatgccttcatcatctgtggcaccttgtacaccgtcagc
agctacacctcagcagatgctaccgtcaactttgcttatgacacaggcacaggtatcagc
aagaccctgaccatcccattcaagaaccgctataagtacagcagcatgattgactacaac
cccctggagaagaagctctttgcctgggacaacttgaacatggtcacttatgacatcaag
ctctccaagatgtga

DBGET integrated database retrieval system