KEGG   Homo sapiens (human): 4654Help
Entry
4654              CDS       T01001                                 

Gene name
MYOD1, MYF3, MYOD, PUM, bHLHc1
Definition
(RefSeq) myogenic differentiation 1
  KO
K09064  
myogenic factor 3
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Myogenic transcription factors
    4654 (MYOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.4
AA seq 320 aa AA seqDB search
MELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMHVGALLKPE
EHSHFPAAVHPAPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERR
RLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAAFYA
PGPLPPGRGGEHYSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCYEGAYYNEAPSEPRP
GKSAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAPSEGESSGDPTQS
PDAAPQCPAGANPNPIYQVL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggagctactgtcgccaccgctccgcgacgtagacctgacggcccccgacggctctctc
tgctcctttgccacaacggacgacttctatgacgacccgtgtttcgactccccggacctg
cgcttcttcgaagacctggacccgcgcctgatgcacgtgggcgcgctcctgaaacccgaa
gagcactcgcacttccccgcggcggtgcacccggccccgggcgcacgtgaggacgagcat
gtgcgcgcgcccagcgggcaccaccaggcgggccgctgcctactgtgggcctgcaaggcg
tgcaagcgcaagaccaccaacgccgaccgccgcaaggccgccaccatgcgcgagcggcgc
cgcctgagcaaagtaaatgaggcctttgagacactcaagcgctgcacgtcgagcaatcca
aaccagcggttgcccaaggtggagatcctgcgcaacgccatccgctatatcgagggcctg
caggctctgctgcgcgaccaggacgccgcgccccctggcgccgcagccgccttctatgcg
ccgggcccgctgcccccgggccgcggcggcgagcactacagcggcgactccgacgcgtcc
agcccgcgctccaactgctccgacggcatgatggactacagcggccccccgagcggcgcc
cggcggcggaactgctacgaaggcgcctactacaacgaggcgcccagcgaacccaggccc
gggaagagtgcggcggtgtcgagcctagactgcctgtccagcatcgtggagcgcatctcc
accgagagccctgcggcgcccgccctcctgctggcggacgtgccttctgagtcgcctccg
cgcaggcaagaggctgccgcccccagcgagggagagagcagcggcgaccccacccagtca
ccggacgccgccccgcagtgccctgcgggtgcgaaccccaacccgatataccaggtgctc
tga

DBGET integrated database retrieval system