KEGG   Homo sapiens (human): 4659Help
Entry
4659              CDS       T01001                                 

Gene name
PPP1R12A, M130, MBS, MYPT1
Definition
protein phosphatase 1, regulatory subunit 12A
Orthology
K06270  
protein phosphatase 1 regulatory subunit 12A
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Vascular smooth muscle contraction
Focal adhesion
Platelet activation
Regulation of actin cytoskeleton
Oxytocin signaling pathway
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    4659 (PPP1R12A)
   04022 cGMP - PKG signaling pathway
    4659 (PPP1R12A)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    4659 (PPP1R12A)
  Cellular commiunity
   04510 Focal adhesion
    4659 (PPP1R12A)
 Organismal Systems
  Immune system
   04611 Platelet activation
    4659 (PPP1R12A)
  Endocrine system
   04921 Oxytocin signaling pathway
    4659 (PPP1R12A)
  Circulatory system
   04270 Vascular smooth muscle contraction
    4659 (PPP1R12A)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    4659 (PPP1R12A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4659 (PPP1R12A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q15-q21
AA seq 1030 aa AA seqDB search
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLL
HRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLD
IAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRD
ARQWLNSGHINDVRHAKSGGTALHVAAAKGYTEVLKLLIQAGYDVNIKDYDGWTPLHAAA
HWGKEEACRILVDNLCDMEMVNKVGQTAFDVADEDILGYLEELQKKQNLLHSEKRDKKSP
LIESTANMDNNQSQKTFKNKETLIIEPEKNASRIESLEQEKVDEEEEGKKDESSCSSEED
EEDDSESEAETDKTKPLASVTNANTSSTQAAPVAVTTPTVSSGQATPTSPIKKFPTTATK
ISPKEEERKDESPATWRLGLRKTGSYGALAEITASKEGQKEKDTAGVTRSASSPRLSSSL
DNKEKEKDSKGTRLAYVAPTIPRRLASTSDIEEKENRDSSSLRTSSSYTRRKWEDDLKKN
SSVNEGSTYHKSCSFGRRQDDLISSSVPSTTSTPTVTSAAGLQKSLLSSTSTTTKITTGS
SSAGTQSSTSNRLWAEDSTEKEKDSVPTAVTIPVAPTVVNAAASTTTLTTTTAGTVSSTT
EVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSRSTRTR
EQENEEKEKEEKEKQDKEKQEEKKESETSREDEYKQKYSRTYDETYQRYRPVSTSSSTTP
SSSLSTMSSSLYASSQLNRPNSLVGITSAYSRGITKENEREGEKREEEKEGEDKSQPKSI
RERRRPREKRRSTGVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYETSSTSAGDR
YDSLLGRSGSYSYLEERKPYSSRLEKDDSTDFKKLYEQILAENEKLKAQLHDTNMELTDL
KLQLEKATQRQERFADRSLLEMEKRERRALERRISEMEEELKMLPDLKADNQRLKDENGA
LIRVISKLSK
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggcggacgcgaagcagaagcggaacgagcagctgaaacgctggatcggctcc
gagacggacctcgagcctccggtggtgaagcgccagaagaccaaggtgaagttcgacgat
ggcgccgtcttcctggctgcttgctccagcggcgacacggacgaggtcctcaagctgctg
caccgcggcgccgacatcaattacgccaatgtggacggactcactgccctgcaccaggct
tgcattgatgacaatgttgatatggtgaagtttctggtagaaaatggagcaaatattaat
caacctgataatgaaggctggataccactacatgcagcagcttcctgtggatatcttgat
attgcagagtttttgattggtcaaggagcacatgtaggggctgtcaacagtgaaggagat
acacctttagatattgcggaggaggaggcaatggaagagctacttcaaaatgaagttaat
cggcaaggggttgatatagaagcagctcgaaaggaagaagaacggatcatgcttagagat
gccaggcagtggctaaatagtggtcatataaatgatgtccggcatgcaaaatctggaggt
acagcacttcacgttgcagctgctaaaggctatacggaagttttaaaacttttaatacag
gcaggctatgatgttaatattaaagactatgatggctggacacctcttcatgctgcagct
cattggggtaaagaagaagcatgtcgaattttagtggacaatctgtgtgatatggagatg
gtcaacaaagtgggccaaacagcctttgatgtagcagatgaagacattttaggatattta
gaagagttgcaaaagaaacaaaatctgctccatagtgaaaaacgggacaagaaatctcca
ctaattgaatcaacagcaaatatggacaataatcagtcacagaagacctttaaaaacaaa
gagacgttgattattgaaccagagaaaaatgcatcccgtattgaatctctggaacaagaa
aaggttgatgaagaagaagaaggaaagaaggatgagtctagctgctctagtgaagaagat
gaggaagatgactcggaatcagaagctgaaacagataagacaaaacccctggcttctgta
actaatgccaacacttctagtacacaagcagctcctgtagctgttacaacacctactgtg
tcatcaggtcaagcaacacctacatcacctattaaaaagtttccaaccacagctacaaaa
atttctcccaaagaagaagagagaaaagatgagtctcctgcaacttggaggttaggactt
agaaagacgggcagctatggtgcacttgctgaaatcacagcatctaaagagggtcagaaa
gaaaaagatactgcaggtgttacacgttcagcttcaagtcccagactttcctcctctttg
gataataaagaaaaggagaaagatagtaaaggaactaggcttgcatatgttgcacctaca
ataccaagacgactagccagtacatctgacattgaagagaaagaaaacagagattcttca
agtttgcgaacaagtagttcatatacaaggagaaaatgggaagatgatcttaaaaaaaat
agctcagttaatgaaggatcaacgtatcataaaagttgctcctttggtagaagacaagat
gatttgattagttctagtgttccaagcaccacatcaacaccaacagttacctctgcagct
gggcttcagaaaagcctgctttccagcacaagcactactacaaagattacaacgggttct
tcctcagcaggcacacaaagcagtacctcaaatcgtttgtgggctgaggatagtactgag
aaagaaaaggacagtgttcctacggcagtgaccattcctgttgctccaactgttgtaaat
gctgcagcttctaccacaaccctgactacaactactgctggcactgtctcctccacaaca
gaggtcagggagagacgcagatcatacctcactcctgttagggatgaagagtctgaatcc
caaagaaaagcaagatctagacaagcaagacaatctagaagatcaacacagggagtgaca
ttaactgatcttcaagaagctgagaaaacaataggaagaagtcgttctacccgaaccaga
gaacaagaaaatgaagaaaaagaaaaagaggaaaaagagaaacaagataaagagaaacaa
gaagaaaagaaggagtcagaaacatctagagaagatgaatataaacaaaagtactccaga
acgtatgatgagacttaccagcgttataggccagtatcaacttcaagttcaaccactcca
tcctcttcactttctactatgagcagttcactgtatgcttcaagtcaactaaacaggcca
aatagtcttgtaggcataacttctgcttactccagaggaataacaaaagaaaatgaaaga
gagggagaaaaaagagaagaggagaaagaaggagaagataaatcacaacctaaatcaatc
agagaacgacgacgaccaagagagaaaagaagatctacaggagtttcattttggacacaa
gatagtgatgaaaatgaacaagaacaacaatcagacacagaagagggatccaataagaaa
gaaactcagacggattccatttctagatatgaaaccagttctacatcagctggtgatcga
tatgattccttgctgggtcgctctggatcatacagttacttagaagaaagaaaaccttac
agcagcaggctagaaaaggatgactcaactgactttaaaaagctttatgaacaaattcta
gctgaaaatgaaaagctgaaggcacagctacatgatacaaatatggaactaacagatctt
aaattacagttggaaaaggccacccagagacaagaaagatttgctgatagatcactgttg
gaaatggaaaaaagggaacgaagagctctagaaagaagaatatctgaaatggaagaagag
ctcaaaatgttaccagacctaaaagcagacaaccagaggctaaaggatgaaaatggggcc
ttgatcagagttataagcaaactttccaaataa

DBGET integrated database retrieval system