KEGG   Homo sapiens (human): 4660Help
Entry
4660              CDS       T01001                                 

Gene name
PPP1R12B, MYPT2, PP1bp55
Definition
protein phosphatase 1, regulatory subunit 12B (EC:3.1.3.53)
Orthology
K12329  
protein phosphatase 1 regulatory subunit 12B
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Oxytocin signaling pathway
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    4660 (PPP1R12B)
  Cell communication
   04510 Focal adhesion
    4660 (PPP1R12B)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    4660 (PPP1R12B)
  Circulatory system
   04270 Vascular smooth muscle contraction
    4660 (PPP1R12B)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    4660 (PPP1R12B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4660 (PPP1R12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q32.1
AA seq 515 aa AA seqDB search
MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGA
VFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQ
DNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQ
GVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAG
YELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLEL
LQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEMEEENKESSSS
SSEEEEGEDEASESETEKEADKKPEAFVNHSNSESKSSITEQIPAPAQNTFSASSARRFS
SGLFNKPEEPKDESPSSWRLGLRKTGSHNMLSEVANSREPIRDRGSSIYRSSSSPRISAL
LDNKDKVQFGRVWGNSKAVFFFHENSILGTNENIF
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcggaactggagcacctaggagggaagcgggcagagtcggcgcgaatgcggcgggca
gagcagcttcggcgctggcggggctcgctgacagagcaggagcctgcggagcgacgaggc
gcggggcggcagccgctgaccaggcgcgggagccccagggtccgcttcgaggacggtgct
gtctttctggccgcctgctctagcggggacaccgacgaggtgagaaagcttctggcaaga
ggtgctgatatcaacacggtcaacgtggacggcttgacagccctgcaccaggcatgtatt
gatgaaaatttggacatggtgaagtttctggtggagaacagagccaatgtaaaccagcaa
gacaacgagggctggacaccccttcatgcagcagcttcctgtggctatctcaacatagca
gagtatttcattaatcacggagccagtgtaggtattgtcaatagtgaaggtgaagttccc
tctgaccttgcagaagagccagccatgaaggatcttcttctggagcaagtaaagaagcaa
ggagttgatctagagcagtcaagaaaagaagaagagcagcagatgttgcaggatgcccgc
cagtggctcaacagtgggaaaatagaggatgtgaggcaggctcgctcaggggctacagcc
cttcatgtggctgctgccaagggctactctgaagtcctcagacttttaattcaggctggc
tatgaactcaatgttcaggattatgatggctggactcccctccatgctgctgcacactgg
ggagtgaaggaggcttgctccatcctggcagaagcactttgtgacatggatattcgaaat
aaactgggccagacaccatttgatgtggctgatgagggtctcgtggagcatttggagttg
ctccagaagaagcagaatgtgcttcgaagtgaaaaggagacacggaataaactcattgag
tcagatctgaacagcaagattcagagtgggttctttaagaacaaagagaagatgctctat
gaggaggagacacctaagtcccaagaaatggaggaagaaaataaagaatctagtagctcc
agctcagaggaggaggaaggtgaagatgaagcttctgagtcagaaactgagaaggaggca
gataaaaagccagaagcctttgtcaatcattccaactctgaaagcaagagtagtatcaca
gagcagataccagcaccagctcaaaataccttctctgcctcttctgctaggaggttctct
tctggcctttttaacaagccagaagagcccaaagatgaatctccttcttcatggagattg
ggactgagaaaaactggcagccacaacatgctgagtgaggtggccaattccagggaacct
ataagggaccgaggctcttccatctatcgctcctcttcaagccctcggatttctgctcta
ctggacaacaaagataaggtgcagtttgggagggtatgggggaattccaaggcagttttt
tttttccatgaaaattcaatcttaggaacaaatgaaaatattttctag

DBGET integrated database retrieval system