KEGG   Homo sapiens (human): 4660Help
Entry
4660              CDS       T01001                                 

Gene name
PPP1R12B, MYPT2, PP1bp55
Definition
protein phosphatase 1, regulatory subunit 12B (EC:3.1.3.53)
Orthology
K12329  
protein phosphatase 1 regulatory subunit 12B
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Oxytocin signaling pathway
Proteoglycans in cancer
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q32.1
AA seq 515 aa AA seqDB search
MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGA
VFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQ
DNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQ
GVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAG
YELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLEL
LQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEMEEENKESSSS
SSEEEEGEDEASESETEKEADKKPEAFVNHSNSESKSSITEQIPAPAQNTFSASSARRFS
SGLFNKPEEPKDESPSSWRLGLRKTGSHNMLSEVANSREPIRDRGSSIYRSSSSPRISAL
LDNKDKVQFGRVWGNSKAVFFFHENSILGTNENIF
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcggaactggagcacctaggagggaagcgggcagagtcggcgcgaatgcggcgggca
gagcagcttcggcgctggcggggctcgctgacagagcaggagcctgcggagcgacgaggc
gcggggcggcagccgctgaccaggcgcgggagccccagggtccgcttcgaggacggtgct
gtctttctggccgcctgctctagcggggacaccgacgaggtgagaaagcttctggcaaga
ggtgctgatatcaacacggtcaacgtggacggcttgacagccctgcaccaggcatgtatt
gatgaaaatttggacatggtgaagtttctggtggagaacagagccaatgtaaaccagcaa
gacaacgagggctggacaccccttcatgcagcagcttcctgtggctatctcaacatagca
gagtatttcattaatcacggagccagtgtaggtattgtcaatagtgaaggtgaagttccc
tctgaccttgcagaagagccagccatgaaggatcttcttctggagcaagtaaagaagcaa
ggagttgatctagagcagtcaagaaaagaagaagagcagcagatgttgcaggatgcccgc
cagtggctcaacagtgggaaaatagaggatgtgaggcaggctcgctcaggggctacagcc
cttcatgtggctgctgccaagggctactctgaagtcctcagacttttaattcaggctggc
tatgaactcaatgttcaggattatgatggctggactcccctccatgctgctgcacactgg
ggagtgaaggaggcttgctccatcctggcagaagcactttgtgacatggatattcgaaat
aaactgggccagacaccatttgatgtggctgatgagggtctcgtggagcatttggagttg
ctccagaagaagcagaatgtgcttcgaagtgaaaaggagacacggaataaactcattgag
tcagatctgaacagcaagattcagagtgggttctttaagaacaaagagaagatgctctat
gaggaggagacacctaagtcccaagaaatggaggaagaaaataaagaatctagtagctcc
agctcagaggaggaggaaggtgaagatgaagcttctgagtcagaaactgagaaggaggca
gataaaaagccagaagcctttgtcaatcattccaactctgaaagcaagagtagtatcaca
gagcagataccagcaccagctcaaaataccttctctgcctcttctgctaggaggttctct
tctggcctttttaacaagccagaagagcccaaagatgaatctccttcttcatggagattg
ggactgagaaaaactggcagccacaacatgctgagtgaggtggccaattccagggaacct
ataagggaccgaggctcttccatctatcgctcctcttcaagccctcggatttctgctcta
ctggacaacaaagataaggtgcagtttgggagggtatgggggaattccaaggcagttttt
tttttccatgaaaattcaatcttaggaacaaatgaaaatattttctag

DBGET integrated database retrieval system