KEGG   Homo sapiens (human): 4669Help
Entry
4669              CDS       T01001                                 

Gene name
NAGLU, MPS-IIIB, MPS3B, NAG, UFHSD
Definition
N-acetylglucosaminidase, alpha (EC:3.2.1.50)
Orthology
K01205  
alpha-N-acetylglucosaminidase [EC:3.2.1.50]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan degradation
Metabolic pathways
Lysosome
Module
Heparan sulfate degradation
Disease
H00130  
Mucopolysaccharidosis type III (MPS3)
H00421  
Mucopolysaccharidosis (MPS)
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:hsa00531]
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21
AA seq 743 aa AA seqDB search
MEAVAVAAAVGVLLLAGAGGAAGDEAREAAAVRALVARLLGPGPAADFSVSVERALAAKP
GLDTYSLGGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWSGSQLRLPRPLPAVPGE
LTEATPNRYRYYQNVCTQSYSFVWWDWARWEREIDWMALNGINLALAWSGQEAIWQRVYL
ALGLTQAEINEFFTGPAFLAWGRMGNLHTWDGPLPPSWHIKQLYLQHRVLDQMRSFGMTP
VLPAFAGHVPEAVTRVFPQVNVTKMGSWGHFNCSYSCSFLLAPEDPIFPIIGSLFLRELI
KEFGTDHIYGADTFNEMQPPSSEPSYLAAATTAVYEAMTAVDTEAVWLLQGWLFQHQPQF
WGPAQIRAVLGAVPRGRLLVLDLFAESQPVYTRTASFQGQPFIWCMLHNFGGNHGLFGAL
EAVNGGPEAARLFPNSTMVGTGMAPEGISQNEVVYSLMAELGWRKDPVPDLAAWVTSFAA
RRYGVSHPDAGAAWRLLLRSVYNCSGEACRGHNRSPLVRRPSLQMNTSIWYNRSDVFEAW
RLLLTSAPSLATSPAFRYDLLDLTRQAVQELVSLYYEEARSAYLSKELASLLRAGGVLAY
ELLPALDEVLASDSRFLLGSWLEQARAAAVSEAEADFYEQNSRYQLTLWGPEGNILDYAN
KQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFDKNVFQLEQAFVLSKQRYPSQPR
GDTVDLAKKIFLKYYPRWVAGSW
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggtggcggtggccgcggcggtgggggtccttctcctggccggggccgggggc
gcggcaggcgacgaggcccgggaggcggcggccgtgcgggcgctcgtggcccggctgctg
gggccaggccccgcggccgacttctccgtgtcggtggagcgcgctctggctgccaagccg
ggcttggacacctacagcctgggcggcggcggcgcggcgcgcgtgcgggtgcgcggctcc
acgggcgtggcggccgccgcggggctgcaccgctacctgcgcgacttctgtggctgccac
gtggcctggtccggctctcagctgcgcctgccgcggccactgccagccgtgccgggggag
ctgaccgaggccacgcccaacaggtaccgctattaccagaatgtgtgcacgcaaagctac
tctttcgtgtggtgggactgggcccgctgggagcgagagatagactggatggcgctgaat
ggcatcaacctggcactggcctggagcggccaggaggccatctggcagcgggtgtacctg
gccttgggcctgacccaggcagagatcaatgagttctttactggtcctgccttcctggcc
tgggggcgaatgggcaacctgcacacctgggatggccccctgcccccctcctggcacatc
aagcagctttacctgcagcaccgggtcctggaccagatgcgctccttcggcatgacccca
gtgctgcctgcattcgcggggcatgttcccgaggctgtcaccagggtgttccctcaggtc
aatgtcacgaagatgggcagttggggccactttaactgttcctactcctgctccttcctt
ctggctccggaagaccccatattccccatcatcgggagcctcttcctgcgagagctgatc
aaagagtttggcacagaccacatctatggggccgacactttcaatgagatgcagccacct
tcctcagagccctcctaccttgccgcagccaccactgccgtctatgaggccatgactgca
gtggatactgaggctgtgtggctgctccaaggctggctcttccagcaccagccgcagttc
tgggggcccgcccagatcagggctgtgctgggagctgtgccccgtggccgcctcctggtt
ctggacctgtttgctgagagccagcctgtgtatacccgcactgcctccttccagggccag
cccttcatctggtgcatgctgcacaactttgggggaaaccatggtctttttggagcccta
gaggctgtgaacggaggcccagaagctgcccgcctcttccccaactccaccatggtaggc
acgggcatggcccccgagggcatcagccagaacgaagtggtctattccctcatggctgag
ctgggctggcgaaaggacccagtgccagatttggcagcctgggtgaccagctttgccgcc
cggcggtatggggtctcccacccggacgcaggggcagcgtggaggctactgctccggagt
gtgtacaactgctccggggaggcctgcaggggccacaatcgtagcccgctggtcaggcgg
ccgtccctacagatgaataccagcatctggtacaaccgatctgatgtgtttgaggcctgg
cggctgctgctcacatctgctccctccctggccaccagccccgccttccgctacgacctg
ctggacctcactcggcaggcagtgcaggagctggtcagcttgtactatgaggaggcaaga
agcgcctacctgagcaaggagctggcctccctgttgagggctggaggcgtcctggcctat
gagctgctgccggcactggacgaggtgctggctagtgacagccgcttcttgctgggcagc
tggctagagcaggcccgagcagcggcagtcagtgaggccgaggccgatttctacgagcag
aacagccgctaccagctgaccttgtgggggccagaaggcaacatcctggactatgccaac
aagcagctggcggggttggtggccaactactacacccctcgctggcggcttttcctggag
gcgctggttgacagtgtggcccagggcatccctttccaacagcaccagtttgacaaaaat
gtcttccaactggagcaggccttcgttctcagcaagcagaggtaccccagccagccgcga
ggagacactgtggacctggccaagaagatcttcctcaaatattacccccgctgggtggcc
ggctcttggtga

DBGET integrated database retrieval system