KEGG   Homo sapiens (human): 467Help
Entry
467               CDS       T01001                                 

Gene name
ATF3
Definition
(RefSeq) activating transcription factor 3
  KO
K09032  
activating transcription factor 3
Organism
hsa  Homo sapiens (human)
Pathway
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    467 (ATF3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    467 (ATF3)
   AP-1(-like) components, CRE-BP/ATF
    467 (ATF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q32.3
AA seq 181 aa AA seqDB search
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSS
ALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK
LESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQ
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttcaacacccaggccaggtctctgcctcggaagtgagtgcttctgccatcgtc
ccctgcctgtcccctcctgggtcactggtgtttgaggattttgctaacctgacgcccttt
gtcaaggaagagctgaggtttgccatccagaacaagcacctctgccaccggatgtcctct
gcgctggaatcagtcactgtcagcgacagacccctcggggtgtccatcacaaaagccgag
gtagcccctgaagaagatgaaaggaaaaagaggcgacgagaaagaaataagattgcagct
gcaaagtgccgaaacaagaagaaggagaagacggagtgcctgcagaaagagtcggagaag
ctggaaagtgtgaatgctgaactgaaggctcagattgaggagctcaagaacgagaagcag
catttgatatacatgctcaaccttcatcggcccacgtgtattgtccgggctcagaatggg
aggactccagaagatgagagaaacctctttatccaacagataaaagaaggaacattgcag
agctaa

DBGET integrated database retrieval system