KEGG   Homo sapiens (human): 4685Help
Entry
4685              CDS       T01001                                 

Gene name
NCAM2, NCAM21
Definition
(RefSeq) neural cell adhesion molecule 2
  KO
K06491  
neural cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Prion diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    4685 (NCAM2)
 Human Diseases
  Neurodegenerative diseases
   05020 Prion diseases
    4685 (NCAM2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    4685 (NCAM2)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   5/2 subfamily
    NCAM; neural cell adhesion molecule [KO:K06491]
     4685 (NCAM2)
   5/3 subfamily
    ROBO3; roundabout, axon guidance receptor 3 [KO:K06755]
     4685 (NCAM2)
   6/5 subfamily
    L1CAM; L1 cell adhesion molecule [KO:K06550]
     4685 (NCAM2)
   6/4 subfamily
    CNTN2; contactin 2 [KO:K06760]
     4685 (NCAM2)
   Enzymatic CD
    FGFR1; fibroblast growth factor receptor 1 [KO:K04362]
     4685 (NCAM2)
    FGFR4; fibroblast growth factor receptor 4 [KO:K05095]
     4685 (NCAM2)
 4. Link Protein Family
  NCAN, CSPG3; neurocan core protein [KO:K06794]
   4685 (NCAM2)
CD molecules [BR:hsa04090]
 Proteins
  4685 (NCAM2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Adhesion molecules of cell surface (General comment) Cell attachment, inflammation, transition
   4685 (NCAM2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  4685 (NCAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O15394(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
21q21.1
AA seq 837 aa AA seqDB search
MSLLLSFYLLGLLVSSGQALLQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEK
IISTQRVVVQKEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREV
VSPQEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTISDNRFAMLANNNLQILNINKSD
EGIYRCEGRVEARGEIDFRDIIVIVNVPPAISMPQKSFNATAERGEEMTFSCRASGSPEP
AISWFRNGKLIEENEKYILKGSNTELTVRNIINSDGGPYVCRATNKAGEDEKQAFLQVFV
QPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSLDGRIEVKGQH
GSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQTIYYSWEGNPINI
SCDVKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNH
IGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASE
IWKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIH
GQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTM
GYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTLFNGLGLGAVIGLGVAALLLILVVTD
VSCFFIRQCGLLMCITRRMCGKKSGSSGKSKELEEGKAAYLKDGSKEPIVEMRTEDERVT
NHEDGSPVNEPNETTPLTEPEKLPLKEEDGKEALNPETIEIKVSNDIIQSKEDDSKA
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcctcctctccttctacctgctggggttgcttgtcagtagcgggcaagctctt
cttcaagtgacaatttcacttagcaaagtagagcttagtgttggagaatctaaattcttc
acatgtacagcgattggtgaacctgaaagtatagattggtataatcctcaaggagagaag
ataatttcaacacagagggtagtagtgcaaaaggaaggtgttaggtcacggttaaccatc
tacaatgcaaatatagaagatgcagggatatatcgttgtcaagcaacagatgccaaagga
caaacacaagaagctacagtagttttggaaatttaccaaaaactcactttcagagaagtg
gtatctccacaagaattcaaacaaggagaagatgcagaagtggtttgccgagttagcagt
tcacctgcacctgctgtcagctggttgtatcataatgaggaagtcaccactatttccgac
aatcggttcgctatgttagcaaacaataacctgcagattctcaacatcaataaaagtgat
gaaggtatatacagatgtgaaggaagagtggaggccaggggagaaattgacttccgtgat
atcattgttattgttaatgtgccgccagcaatctcaatgcctcagaaatcttttaatgcc
acagcagagagaggagaagaaatgacattttcctgcagggcctcaggctctccagaaccc
gccatctcctggttcaggaatggcaagctcattgaagaaaatgagaagtacatattgaaa
gggagcaatacagaactcactgtcaggaacataatcaatagtgatggtggtccttatgtc
tgcagggccacaaataaggcaggagaagatgaaaagcaagctttcctccaagtctttgta
cagcctcacataatacagcttaaaaatgaaactacatatgagaatggtcaagtcacactc
gtatgtgatgcggaaggggagcctattccagaaatcacttggaaaagagctgtggatggc
ttcacgttcactgaaggcgataagagcctggacggccgtatcgaagtcaaagggcagcat
ggaagctcatcactgcatattaaagatgtgaagttgtcagattcagggagatatgactgt
gaagctgcaagcagaattggagggcatcaaaagagcatgtaccttgatattgaatatgcc
cccaagtttatatcaaaccaaacaatttattactcttgggaaggaaatcctatcaatata
agttgtgatgtgaaatcgaatccaccagcatcaattcactggagaagagataaattagtc
ttacctgctaaaaacacgaccaatttaaagacttatagtacaggaagaaagatgatatta
gagattgcacctacatctgacaatgactttggacgctataattgcacagccactaatcat
ataggaacaagatttcaagaatatattcttgctttggctgacgtgccatccagtccctat
ggagtgaagatcatagagctgtcgcagaccacggccaaggtttccttcaacaaaccggac
tcccatggaggtgtacctattcatcactatcaggtggatgtcaaagaagtagcgtcagaa
atctggaaaattgtacgctcccatggagttcaaacaatggttgttttgaacaacctggaa
ccaaatacaacttatgaaatcagggttgcagctgtaaatggaaagggacaaggagactac
agtaaaatagaaatcttccaaacattaccagttcgtgaaccaagtcctccatccatacat
ggacagccaagcagtggaaagagctttaaactcagcatcaccaaacaggacgatggaggg
gcccctattttggaatacattgtgaaatatagaagtaaagataaggaagaccaatggcta
gagaaaaaagtgcaaggaaataaagaccacatcattttggagcatctccagtggaccatg
gggtatgaagttcagattacagctgccaatagattgggatattctgaaccgacagtttat
gaattcagcatgccaccaaagcccaacattattaaagacacgctgtttaatggtcttggg
cttggagcagtaattggcctgggagttgctgcactgctgctaattcttgtggtaacagac
gtcagctgcttctttattcggcaatgtgggttgctgatgtgcatcactaggagaatgtgt
ggaaagaaaagtggctccagtggcaaaagtaaagaactcgaagaaggaaaagctgcatac
ctgaaagatggatcaaaagaaccaatagtggagatgagaacagaggatgaaagagttact
aatcacgaagatgggagcccagtaaatgagccaaatgaaaccacaccactgacagaacct
gaaaaattgcctttaaaggaagaagatgggaaagaagctctaaatccagaaactatagaa
attaaagtttctaacgacatcattcaatcaaaagaagacgacagcaaagcataa

DBGET integrated database retrieval system