KEGG   Homo sapiens (human): 4685Help
Entry
4685              CDS       T01001                                 

Gene name
NCAM2, NCAM21
Definition
neural cell adhesion molecule 2
Orthology
K06491  
neural cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Prion diseases
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:hsa05020]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
21q21.1
AA seq 837 aa AA seqDB search
MSLLLSFYLLGLLVSSGQALLQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEK
IISTQRVVVQKEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREV
VSPQEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTISDNRFAMLANNNLQILNINKSD
EGIYRCEGRVEARGEIDFRDIIVIVNVPPAISMPQKSFNATAERGEEMTFSCRASGSPEP
AISWFRNGKLIEENEKYILKGSNTELTVRNIINSDGGPYVCRATNKAGEDEKQAFLQVFV
QPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSLDGRIEVKGQH
GSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQTIYYSWEGNPINI
SCDVKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNH
IGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASE
IWKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIH
GQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTM
GYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTLFNGLGLGAVIGLGVAALLLILVVTD
VSCFFIRQCGLLMCITRRMCGKKSGSSGKSKELEEGKAAYLKDGSKEPIVEMRTEDERVT
NHEDGSPVNEPNETTPLTEPEKLPLKEEDGKEALNPETIEIKVSNDIIQSKEDDSKA
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcctcctctccttctacctgctggggttgcttgtcagtagcgggcaagctctt
cttcaagtgacaatttcacttagcaaagtagagcttagtgttggagaatctaaattcttc
acatgtacagcgattggtgaacctgaaagtatagattggtataatcctcaaggagagaag
ataatttcaacacagagggtagtagtgcaaaaggaaggtgttaggtcacggttaaccatc
tacaatgcaaatatagaagatgcagggatatatcgttgtcaagcaacagatgccaaagga
caaacacaagaagctacagtagttttggaaatttaccaaaaactcactttcagagaagtg
gtatctccacaagaattcaaacaaggagaagatgcagaagtggtttgccgagttagcagt
tcacctgcacctgctgtcagctggttgtatcataatgaggaagtcaccactatttccgac
aatcggttcgctatgttagcaaacaataacctgcagattctcaacatcaataaaagtgat
gaaggtatatacagatgtgaaggaagagtggaggccaggggagaaattgacttccgtgat
atcattgttattgttaatgtgccgccagcaatctcaatgcctcagaaatcttttaatgcc
acagcagagagaggagaagaaatgacattttcctgcagggcctcaggctctccagaaccc
gccatctcctggttcaggaatggcaagctcattgaagaaaatgagaagtacatattgaaa
gggagcaatacagaactcactgtcaggaacataatcaatagtgatggtggtccttatgtc
tgcagggccacaaataaggcaggagaagatgaaaagcaagctttcctccaagtctttgta
cagcctcacataatacagcttaaaaatgaaactacatatgagaatggtcaagtcacactc
gtatgtgatgcggaaggggagcctattccagaaatcacttggaaaagagctgtggatggc
ttcacgttcactgaaggcgataagagcctggacggccgtatcgaagtcaaagggcagcat
ggaagctcatcactgcatattaaagatgtgaagttgtcagattcagggagatatgactgt
gaagctgcaagcagaattggagggcatcaaaagagcatgtaccttgatattgaatatgcc
cccaagtttatatcaaaccaaacaatttattactcttgggaaggaaatcctatcaatata
agttgtgatgtgaaatcgaatccaccagcatcaattcactggagaagagataaattagtc
ttacctgctaaaaacacgaccaatttaaagacttatagtacaggaagaaagatgatatta
gagattgcacctacatctgacaatgactttggacgctataattgcacagccactaatcat
ataggaacaagatttcaagaatatattcttgctttggctgacgtgccatccagtccctat
ggagtgaagatcatagagctgtcgcagaccacggccaaggtttccttcaacaaaccggac
tcccatggaggtgtacctattcatcactatcaggtggatgtcaaagaagtagcgtcagaa
atctggaaaattgtacgctcccatggagttcaaacaatggttgttttgaacaacctggaa
ccaaatacaacttatgaaatcagggttgcagctgtaaatggaaagggacaaggagactac
agtaaaatagaaatcttccaaacattaccagttcgtgaaccaagtcctccatccatacat
ggacagccaagcagtggaaagagctttaaactcagcatcaccaaacaggacgatggaggg
gcccctattttggaatacattgtgaaatatagaagtaaagataaggaagaccaatggcta
gagaaaaaagtgcaaggaaataaagaccacatcattttggagcatctccagtggaccatg
gggtatgaagttcagattacagctgccaatagattgggatattctgaaccgacagtttat
gaattcagcatgccaccaaagcccaacattattaaagacacgctgtttaatggtcttggg
cttggagcagtaattggcctgggagttgctgcactgctgctaattcttgtggtaacagac
gtcagctgcttctttattcggcaatgtgggttgctgatgtgcatcactaggagaatgtgt
ggaaagaaaagtggctccagtggcaaaagtaaagaactcgaagaaggaaaagctgcatac
ctgaaagatggatcaaaagaaccaatagtggagatgagaacagaggatgaaagagttact
aatcacgaagatgggagcccagtaaatgagccaaatgaaaccacaccactgacagaacct
gaaaaattgcctttaaaggaagaagatgggaaagaagctctaaatccagaaactatagaa
attaaagtttctaacgacatcattcaatcaaaagaagacgacagcaaagcataa

DBGET integrated database retrieval system