KEGG   Homo sapiens (human): 4686Help
Entry
4686              CDS       T01001                                 

Gene name
NCBP1, CBP80, NCBP, Sto1
Definition
(RefSeq) nuclear cap binding protein subunit 1
  KO
K12882  
nuclear cap-binding protein subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mRNA surveillance pathway
Spliceosome
Module
Cap binding complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    4686 (NCBP1)
  Translation
   03013 RNA transport
    4686 (NCBP1)
   03015 mRNA surveillance pathway
    4686 (NCBP1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA processing factors
   5' end processing
    Cap binding complex
     4686 (NCBP1)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   Cap binding complex
    4686 (NCBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.1
AA seq 790 aa AA seqDB search
MSRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEAD
LPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANN
YNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQVRRDWYVYAFLSSLPWV
GKELYEKKDAEMDRIFANTESYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLK
KDRWQERHILRPYLAFDSILCEALQHNLPPFTPPPHTEDSVYPMPRVIFRMFDYTDDPEG
PVMPGSHSVERFVIEENLHCIIKSHWKERKTCAAQLVSYPGKNKIPLNYHIVEVIFAELF
QLPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYMRLDTMNTTCVDRFINWFSHH
LSNFQFRWSWEDWSDCLSQDPESPKPKFVREVLEKCMRLSYHQRILDIVPPTFSALCPAN
PTCIYKYGDESSNSLPGHSVALCLAVAFKSKATNDEIFSILKDVPNPNQDDDDDEGFSFN
PLKIEVFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESDEGKLHVLRVMFEVWRNHPQM
IAVLVDKMIRTQIVDCAAVANWIFSSELSRDFTRLFVWEILHSTIRKMNKHVLKIQKELE
EAKEKLARQHKRRSDDDDRSSDRKDGVLEEQIERLQEKVESAQSEQKNLFLVIFQRFIMI
LTEHLVRCETDGTSVLTPWYKNCIERLQQIFLQHHQIIQQYMVTLENLLFTAELDPHILA
VFQQFCALQA
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggcggcggcacagcgacgagaacgacggtgggcagcctcacaaaaggagaaag
acctctgatgcaaatgaaactgaagatcatttggaatctttaatatgtaaagtaggagaa
aagagtgcctgctctttggagagcaacctagaaggcttggctggtgttttggaagctgat
cttcctaactacaagagcaagatcttaaggcttctttgtacagttgcacgcctattacct
gagaagctgacaatttatacaacattagttggactactgaatgccaggaattacaatttt
ggtggagaatttgtagaagccatgattcgtcaacttaaagaatcattgaaagcaaacaat
tataatgaagccgtgtatttggtccgttttttatctgatcttgtgaattgtcatgtgatt
gccgccccatcaatggttgctatgtttgaaaattttgtaagcgtaactcaggaagaagat
gtacctcaggtgcgacgagattggtatgtgtatgcatttctgtcatctttgccctgggtt
ggaaaggagttgtacgaaaagaaagatgcagagatggaccgcatctttgccaacactgaa
agctatcttaaaagacgccaaaagactcatgtacccatgttacaggtatggactgctgat
aaaccacatccacaagaagagtatttagattgcctgtgggcccagattcagaaattgaaa
aaggatcgctggcaggaacggcacatcctaagaccttatcttgcctttgacagcatcctg
tgtgaagcactgcagcacaatctgcctccttttacaccacctcctcacactgaagattca
gtgtacccaatgccaagggtcatcttcagaatgtttgattacacagatgatcccgagggt
cctgtcatgccagggagtcattcagtggaaagatttgtaatagaagagaatcttcactgc
atcattaagtcccactggaaggaaaggaagacttgtgctgcacagttagtgagctatcca
gggaagaacaagatccccttgaactaccacatagttgaggtgatctttgcagagctgttt
caacttccagcaccccctcacattgatgtgatgtacacaacactcctcattgaactgtgc
aaacttcaacctggctctctaccccaagttcttgcacaggcaactgaaatgctatacatg
cgtttggacacaatgaacactacctgtgtagacaggtttattaattggttttctcatcat
ctaagtaacttccagttccgttggagctgggaagattggtcagattgtcttagtcaagat
cctgaaagtcccaaaccgaagtttgtaagagaagttctagaaaaatgtatgaggttgtct
taccatcagcgtatattagatattgttcctcctaccttctcagctctgtgtcctgcaaac
ccaacctgcatttacaagtatggagatgaaagtagcaattctcttcctggacattctgtt
gccctctgtttagctgttgcctttaaaagtaaggcaaccaatgatgaaatcttcagcatt
ctgaaagatgtaccaaatcctaaccaggatgatgacgacgatgaaggattcagttttaac
ccattgaaaatagaagtctttgtacagactctgctacacttggcagccaaatcattcagc
cactccttcagtgctcttgcaaagtttcatgaagtcttcaaaaccctagctgaaagtgat
gaaggaaagttacatgtgctaagagttatgtttgaggtctggaggaaccatccacagatg
attgctgtactagtggataagatgattcgtacacaaatagttgattgtgctgccgtagca
aattggatcttctcttcagaactatctcgtgactttaccagattgtttgtttgggaaatt
ttgcactctacaattcgtaagatgaacaaacatgtcctgaagatccagaaagagctggaa
gaagctaaagagaaacttgctaggcaacacaaacggcgaagtgatgatgacgacagaagc
agtgacaggaaagacggggttcttgaggaacaaatagaacgacttcaggaaaaagtggaa
tctgctcagagtgaacaaaagaatcttttcctcgttatatttcagcggtttatcatgatc
ttgaccgagcacctagtacgatgcgaaactgatgggaccagtgtattaacaccatggtat
aagaactgtatagagaggctgcagcagatcttcctacagcatcaccaaataatccagcag
tacatggtgaccctggagaaccttctcttcactgctgaattagaccctcatatcttggcc
gtgttccagcagttctgtgccctgcaggcctaa

DBGET integrated database retrieval system