KEGG   Homo sapiens (human): 4689Help
Entry
4689              CDS       T01001                                 

Gene name
NCF4, NCF, P40PHOX, SH3PXD4
Definition
neutrophil cytosolic factor 4, 40kDa
Orthology
K08012  
neutrophil cytosolic factor 4
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Osteoclast differentiation
Leukocyte transendothelial migration
Leishmaniasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    4689 (NCF4)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    4689 (NCF4)
  Development
   04380 Osteoclast differentiation
    4689 (NCF4)
 Human Diseases
  Infectious diseases
   05140 Leishmaniasis
    4689 (NCF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.1
AA seq 339 aa AA seqDB search
MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYR
QFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLP
VWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFD
FTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWL
RCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSD
EDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggcccagcagctgcgggccgagagtgactttgaacagcttccggatgatgtt
gccatctcggccaacattgctgacatcgaggagaagagaggcttcaccagccactttgtt
ttcgtcatcgaggtgaagacaaaaggaggatccaagtacctcatctaccgccgctaccgc
cagttccatgctttgcagagcaagctggaggagcgcttcgggccagacagcaagagcagt
gccctggcctgtaccctgcccacactcccagccaaagtctacgtgggtgtgaaacaggag
atcgccgagatgcggatacctgccctcaacgcctacatgaagagcctgctcagcctgccg
gtctgggtgctgatggatgaggacgtccggatcttcttttaccagtcgccctatgactca
gagcaggtgccccaggcactccgccggctccgcccgcgcacccggaaagtcaagagcgtg
tccccacagggcaacagcgttgaccgcatggcagctccgagagcagaggctctatttgac
ttcactggaaacagcaaactggagctgaatttcaaagctggagatgtgatcttcctcctc
agtcggatcaacaaagactggctggagggcactgtccggggagccacgggcatcttccct
ctctccttcgtgaagatcctcaaagacttccctgaggaggacgaccccaccaactggctg
cgttgctactactacgaagacaccatcagcaccatcaaggacatcgcggtggaggaagat
ctcagcagcactcccctattgaaagacctgctggagctcacaaggcgggagttccagaga
gaggacatagctctgaattaccgggacgctgagggggatctggttcggctgctgtcggat
gaggacgtagcgctcatggtgcggcaggctcgtggcctcccctcccagaagcgcctcttc
ccctggaagctgcacatcacgcagaaggacaactacagggtctacaacacgatgccatga

DBGET integrated database retrieval system