KEGG   Homo sapiens (human): 4690Help
Entry
4690              CDS       T01001                                 

Gene name
NCK1, NCK, NCKalpha, nck-1
Definition
(RefSeq) NCK adaptor protein 1
  KO
K07365  
NCK adaptor protein 1
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Axon guidance
T cell receptor signaling pathway
Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    4690 (NCK1)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    4690 (NCK1)
  Development
   04360 Axon guidance
    4690 (NCK1)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    4690 (NCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q21
AA seq 377 aa AA seqDB search
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLA
AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVG
LVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLVKHLS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaagtggtggtagtagccaaatttgattatgtggcccaacaagaacaagag
ttggacatcaagaagaatgagagattatggcttctggatgattctaagtcctggtggcga
gttcgaaattccatgaataaaacaggttttgtgccttctaactatgtggaaaggaaaaac
agtgctcggaaagcatctattgtgaaaaacctaaaggataccttaggcattggaaaagtg
aaaagaaaacctagtgtgccagattctgcatctcctgctgatgatagttttgttgaccca
ggggaacgtctctatgacctcaacatgcccgcttatgtgaaatttaactacatggctgag
agagaggatgaattatcattgataaaggggacaaaggtgatcgtcatggagaaatgcagt
gatgggtggtggcgtggtagctacaatggacaagttggatggttcccttcaaactatgta
actgaagaaggtgacagtcctttgggtgaccatgtgggttctctgtcagagaaattagca
gcagtcgtcaataacctaaatactgggcaagtgttgcatgtggtacaggctctttaccca
ttcagctcatctaatgatgaagaacttaatttcgagaaaggagatgtaatggatgttatt
gaaaaacctgaaaatgacccagagtggtggaaatgcaggaagatcaatggtatggttggt
ctagtaccaaaaaactatgttaccgttatgcagaataatccattaacttcaggtttggaa
ccatcacctccacagtgtgattacattaggccttcactcactggaaagtttgctggcaat
ccttggtattatggcaaagtcaccaggcatcaagcagaaatggcattaaatgaaagagga
catgaaggggatttcctcattcgtgatagtgaatcttcgccaaatgatttctcagtatca
ctaaaagcacaagggaaaaacaagcattttaaagtccaactaaaagagactgtctactgc
attgggcagcgtaaattcagcaccatggaagaacttgtagaacattacaaaaaggcacca
atttttacaagtgaacaaggagaaaaattatatcttgtcaagcatttatcatga

DBGET integrated database retrieval system