KEGG   Homo sapiens (human): 4690Help
Entry
4690              CDS       T01001                                 

Gene name
NCK1, NCK, NCKalpha, nck-1
Definition
NCK adaptor protein 1
Orthology
K07365  
NCK adaptor protein
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Axon guidance
T cell receptor signaling pathway
Pathogenic Escherichia coli infection
Class
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:hsa04012]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q21
AA seq 313 aa AA seqDB search
MDWLNVFKDFFSIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAEREDE
LSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLAAVVN
NLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPK
NYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGHEGD
FLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAPIFTS
EQGEKLYLVKHLS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggattggttaaacgtctttaaagattttttcagcattggaaaagtgaaaagaaaacct
agtgtgccagattctgcatctcctgctgatgatagttttgttgacccaggggaacgtctc
tatgacctcaacatgcccgcttatgtgaaatttaactacatggctgagagagaggatgaa
ttatcattgataaaggggacaaaggtgatcgtcatggagaaatgcagtgatgggtggtgg
cgtggtagctacaatggacaagttggatggttcccttcaaactatgtaactgaagaaggt
gacagtcctttgggtgaccatgtgggttctctgtcagagaaattagcagcagtcgtcaat
aacctaaatactgggcaagtgttgcatgtggtacaggctctttacccattcagctcatct
aatgatgaagaacttaatttcgagaaaggagatgtaatggatgttattgaaaaacctgaa
aatgacccagagtggtggaaatgcaggaagatcaatggtatggttggtctagtaccaaaa
aactatgttaccgttatgcagaataatccattaacttcaggtttggaaccatcacctcca
cagtgtgattacattaggccttcactcactggaaagtttgctggcaatccttggtattat
ggcaaagtcaccaggcatcaagcagaaatggcattaaatgaaagaggacatgaaggggat
ttcctcattcgtgatagtgaatcttcgccaaatgatttctcagtatcactaaaagcacaa
gggaaaaacaagcattttaaagtccaactaaaagagactgtctactgcattgggcagcgt
aaattcagcaccatggaagaacttgtagaacattacaaaaaggcaccaatttttacaagt
gaacaaggagaaaaattatatcttgtcaagcatttatcatga

DBGET integrated database retrieval system